| Clone Name | baal12n09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHE1_CHEAL (Q8LGR0) Pollen allergen Che a 1 precursor | 33 | 0.42 | 2 | ALL1_OLEEU (P19963) Major pollen allergen (Allergen Ole e 1) (Ol... | 30 | 2.7 | 3 | LOLB_LOLPR (Q7M1X5) Major pollen allergen Lol p 11 (Lol p XI) | 30 | 3.5 | 4 | OLEE1_BETVE (O49813) Olee1-like protein precursor | 29 | 4.6 | 5 | PPS3_BACSU (P39847) Peptide synthetase 3 | 29 | 4.6 |
|---|
>CHE1_CHEAL (Q8LGR0) Pollen allergen Che a 1 precursor| Length = 168 Score = 32.7 bits (73), Expect = 0.42 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +1 Query: 178 EIRGRVVCDVCADSAIGPEDHVLEGAEVAVLC--ITKSGEVINYQAFTNYKGVYSVAETM 351 +++G V CD C + ++EGA V + C IT + +A T+ G YS+ Sbjct: 31 KVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNG 90 Query: 352 PESDRWDSCLARPISSFHQHCT 417 D D C + S + C+ Sbjct: 91 DFED--DICEIELVKSPNSECS 110
>ALL1_OLEEU (P19963) Major pollen allergen (Allergen Ole e 1) (Ole e I)| Length = 145 Score = 30.0 bits (66), Expect = 2.7 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = +1 Query: 181 IRGRVVCDVCADSAIGPEDHVLEGAEVAVLCITKSGEVINYQ--AFTNYKGVYSVAETMP 354 I+G+V CD C I + GA + + C K + + +T +G+YS+ + Sbjct: 13 IQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSM--LVE 70 Query: 355 ESDRWDSCLARPISSFHQHC 414 + + C ISS + C Sbjct: 71 RDHKNEFCEITLISSGRKDC 90
>LOLB_LOLPR (Q7M1X5) Major pollen allergen Lol p 11 (Lol p XI)| Length = 134 Score = 29.6 bits (65), Expect = 3.5 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +1 Query: 181 IRGRVVCDVCADSAIGPEDHVLEGAEVAVLCITKSG--EVINYQAFTNYKGVYSV 339 + GRV CD C H +EGA VAV C G + +A T+ G Y + Sbjct: 8 VTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKI 62
>OLEE1_BETVE (O49813) Olee1-like protein precursor| Length = 166 Score = 29.3 bits (64), Expect = 4.6 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 181 IRGRVVCDVCADSAIGPEDHVLEGAEVAVLCITKSGEVINY--QAFTNYKGVYSV 339 + G+V CD C + ++GA+V++ C + G + Y + T+ G Y + Sbjct: 29 VEGKVYCDNCRTQFVTKLSTYMKGAKVSLECRNREGGTLIYSSDSETDKSGTYRI 83
>PPS3_BACSU (P39847) Peptide synthetase 3| Length = 2555 Score = 29.3 bits (64), Expect = 4.6 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 32 PCSLGKGKEQTNSWRRPRVLSLTGV 106 P SLG GK+ T++W+R +++ ++ + Sbjct: 2458 PSSLGSGKDITHTWKREQIIEMSAM 2482 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,846,277 Number of Sequences: 219361 Number of extensions: 952879 Number of successful extensions: 3286 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3285 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)