| Clone Name | baal13c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BXC1_CLOBO (P18640) Botulinum neurotoxin type C1 precursor (EC 3... | 30 | 2.6 | 2 | CY561_HUMAN (P49447) Cytochrome b561 (Cytochrome b-561) | 30 | 3.4 | 3 | ELOA1_DROME (Q9VCP0) Transcription elongation factor B polypepti... | 29 | 5.8 | 4 | HEATR_ARATH (Q9C8Z4) Hypothetical protein At3g06530 | 28 | 9.9 | 5 | PIGR_BOVIN (P81265) Polymeric-immunoglobulin receptor precursor ... | 28 | 9.9 |
|---|
>BXC1_CLOBO (P18640) Botulinum neurotoxin type C1 precursor (EC 3.4.24.69)| (BoNT/C1) (Bontoxilysin C1) [Contains: Botulinum neurotoxin C1 light chain; Botulinum neurotoxin C1 heavy chain] Length = 1290 Score = 30.0 bits (66), Expect = 2.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 147 GNTTGRIINVQGQNIIYNLLYQSLS 73 G G++I Q +NI+YN +Y+S S Sbjct: 914 GEDRGKVIVTQNENIVYNSMYESFS 938
>CY561_HUMAN (P49447) Cytochrome b561 (Cytochrome b-561)| Length = 251 Score = 29.6 bits (65), Expect = 3.4 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 277 SIGSKLLGISKVQMFNGSNKDSDSSSEDITSKVEEILLSC 396 S+G+ LLG+ + +FN K S E + + V +LL+C Sbjct: 171 SVGTALLGLKEALLFNLGGKYSAFEPEGVLANVLGLLLAC 210
>ELOA1_DROME (Q9VCP0) Transcription elongation factor B polypeptide 3 (RNA| polymerase II transcription factor SIII subunit A) (Elongin A) (dEloA) Length = 643 Score = 28.9 bits (63), Expect = 5.8 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +1 Query: 325 GSNKDSDSSSEDITSKVEEILLSCKEIKPLD 417 GS+K++ S+S TSK E+L S +++PLD Sbjct: 334 GSSKEALSTSSRPTSKKPELLASTAKLEPLD 364
>HEATR_ARATH (Q9C8Z4) Hypothetical protein At3g06530| Length = 1830 Score = 28.1 bits (61), Expect = 9.9 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = -1 Query: 156 SCCGNTTGRIINVQGQN-------IIYNLLYQSLSPEDAAARGGGADPEQR 25 S C TTG +INV G I+ NL+ QSL A+ G A E++ Sbjct: 1371 SSCLRTTGALINVLGPKALIELPCIMKNLVKQSLEVSFASQSGRNATAEEQ 1421
>PIGR_BOVIN (P81265) Polymeric-immunoglobulin receptor precursor (Poly-Ig| receptor) (PIGR) [Contains: Secretory component] Length = 757 Score = 28.1 bits (61), Expect = 9.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 135 GRIINVQGQNIIYNLLYQSLSPEDAAARGGGADPEQREQ 19 GRI++V N ++++ SL EDA GA PE Q Sbjct: 295 GRIVSVPKDNGVFSVHITSLRKEDAGRYVCGAQPEGEPQ 333 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,422,733 Number of Sequences: 219361 Number of extensions: 969788 Number of successful extensions: 2274 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2273 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)