| Clone Name | baal13b22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DDX51_HUMAN (Q8N8A6) ATP-dependent RNA helicase DDX51 (EC 3.6.1.... | 30 | 7.6 | 2 | IF2_PROMM (Q7V5M4) Translation initiation factor IF-2 | 30 | 7.6 | 3 | PP2C3_YEAST (P34221) Protein phosphatase 2C homolog 3 (EC 3.1.3.... | 29 | 9.9 |
|---|
>DDX51_HUMAN (Q8N8A6) ATP-dependent RNA helicase DDX51 (EC 3.6.1.-) (DEAD box| protein 51) Length = 666 Score = 29.6 bits (65), Expect = 7.6 Identities = 16/29 (55%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = -1 Query: 159 LAAAACGFLAGRG-------CVSLSWGSG 94 L +AACGFL GRG CVS GSG Sbjct: 233 LESAACGFLVGRGGYRPSDLCVSAPTGSG 261
>IF2_PROMM (Q7V5M4) Translation initiation factor IF-2| Length = 1125 Score = 29.6 bits (65), Expect = 7.6 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -3 Query: 589 RPFDIPISIAGTPSQETPTMPTRHSSNRPAGYEP 488 RP + PIS PS+ PT PT S+N+P+ P Sbjct: 150 RPINAPISRPAIPSR--PTAPTPRSANKPSSPVP 181
>PP2C3_YEAST (P34221) Protein phosphatase 2C homolog 3 (EC 3.1.3.16) (PP2C-3)| Length = 468 Score = 29.3 bits (64), Expect = 9.9 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 453 CGDIMLAYIKLHGSYPAGLLEECLV 527 CG M++ +K S+ +G+LE+CL+ Sbjct: 73 CGSKMISILKKQESFKSGMLEQCLI 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,765,945 Number of Sequences: 219361 Number of extensions: 1582294 Number of successful extensions: 5348 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5345 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)