| Clone Name | baal12m15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLR_KYMVJ (P36304) RNA replicase polyprotein (EC 2.7.7.48) | 28 | 4.9 | 2 | YL_DROME (P98163) Putative vitellogenin receptor precursor (Prot... | 28 | 4.9 | 3 | PTN14_MOUSE (Q62130) Tyrosine-protein phosphatase non-receptor t... | 28 | 8.3 | 4 | PTN14_HUMAN (Q15678) Tyrosine-protein phosphatase non-receptor t... | 28 | 8.3 |
|---|
>POLR_KYMVJ (P36304) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1874 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 165 NSPKPNKQTPTYSSTLP 115 N P PNK TPT SST P Sbjct: 693 NPPAPNKPTPTSSSTTP 709
>YL_DROME (P98163) Putative vitellogenin receptor precursor (Protein yolkless)| (YL) Length = 1984 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 30 DYGIRCLCQNKYRISG--CCHVLGSETFVLLAMCWSKLE 140 DYG C+C N+ G C H G+E VL A+ +LE Sbjct: 1751 DYGYECMCGNRLVAEGERCPHGSGNEVAVLGAVNSLELE 1789
>PTN14_MOUSE (Q62130) Tyrosine-protein phosphatase non-receptor type 14 (EC| 3.1.3.48) (Protein-tyrosine phosphatase PTP36) Length = 1189 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -1 Query: 207 YKSYIESTIDCMS*NSPKPNKQTPTYS-STLPRAQKF 100 +K Y ++ I NSP P ++ PT+S S+LPR Q + Sbjct: 299 HKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPY 335
>PTN14_HUMAN (Q15678) Tyrosine-protein phosphatase non-receptor type 14 (EC| 3.1.3.48) (Protein-tyrosine phosphatase pez) Length = 1187 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -1 Query: 207 YKSYIESTIDCMS*NSPKPNKQTPTYS-STLPRAQKF 100 +K Y ++ I NSP P ++ PT+S S+LPR Q + Sbjct: 299 HKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPY 335 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,284,495 Number of Sequences: 219361 Number of extensions: 565026 Number of successful extensions: 1190 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)