ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal12h18 |
|---|---|
| Clone Library Name | barley_pub |
>USH2A_MOUSE (Q2QI47) Usherin precursor (Usher syndrome type-2A protein homolog)| (Usher syndrome type IIa protein homolog) Length = 5193 Score = 32.0 bits (71), Expect = 0.42 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 189 VEASSHLNCCCRKPYSPWKRRICHSAPPQGATPP 88 VEA + NCC R P + + H APP G +PP Sbjct: 4796 VEACTCFNCCSRGPTAELRT---HPAPPSGLSPP 4826
>GCH3_SULSO (Q980B6) GTP cyclohydrolase III (EC 3.5.4.29)| Length = 231 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +3 Query: 66 IRLLSCKLEGSPLVEAQNDKFSASMVNRVFCNNNSDDSTLQQLTSDATIEVAIDIPFPFQ 245 +R+ SC G +EAQ N C NN DD+ +++ T + + DI F + Sbjct: 81 VRIKSCLGYGKTPLEAQ--------WNASICLNNQDDNEIKEYTDEKIAALHFDINFNTE 132 Query: 246 ALPVEAI 266 L ++ Sbjct: 133 TLKYTSV 139
>KHSE_BACSU (P04948) Homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 309 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 84 KLEGSPLVEAQNDKFSASMVNRVFCNNNSDDSTLQQLTSDATIEVAIDIPF 236 KL + L E D AS+V + + DD T +A I+V + IPF Sbjct: 123 KLHLASLEEGHPDNAGASLVGGLVIGLHEDDETQMIRVPNADIDVVVVIPF 173
>MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2330 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 162 CCRKPYSPWKRRICHSAPPQGATPPAC 82 C R P W + C +APP G AC Sbjct: 112 CSRDPECSWCQGACQAAPPPGTPSGAC 138
>PRDM2_RAT (Q63755) PR domain zinc finger protein 2 (PR domain-containing| protein 2) (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) Length = 1706 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 162 CCRKPYSPWKRRICHSAPPQG-ATPPACRRGGGCSSR 55 C +KP SP KR++ HS+ G A+ + R C R Sbjct: 1466 CPKKPLSPSKRKVSHSSKKGGHASSSSSDRNSSCHPR 1502
>PRDM2_HUMAN (Q13029) PR domain zinc finger protein 2 (PR domain-containing| protein 2) (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) (MTE-binding protein) (MTB-ZF) (GATA-3-binding protein G3B) Length = 1718 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 162 CCRKPYSPWKRRICHSAPPQGATPPA 85 C +KP SP K+++ HS+ G + PA Sbjct: 1478 CPKKPLSPPKKKVSHSSKKGGHSSPA 1503
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 150 PYSPWKRRICHSAPP-QGATPPACRRGGGCSSR 55 P P KRR+ HS PP Q ++P RR SS+ Sbjct: 641 PSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSK 673
>UT14B_MOUSE (Q6EJB6) U3 small nucleolar RNA-associated protein 14 homolog B| (Juvenile spermatogonial depletion protein) Length = 756 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 139 MEAENLSFCASTRGDPSSLQERRR 68 ++AEN+ +C+STR D S LQ ++ Sbjct: 716 IKAENVGYCSSTRSDLSILQSSQK 739
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 162 CCRKPYSPWKRRICHSAPPQGATPPAC 82 C R P W + C +APP G AC Sbjct: 112 CSRDPECSWCQGACQAAPPPGTPLGAC 138
>C3G_DROME (O77086) Guanine nucleotide-releasing factor 2 (CRK SH3-binding| GNRP) Length = 1571 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = -1 Query: 141 PWKRRICHSAPPQGATPPACRR-----GGGCSS 58 P K +CH + +TP C GGGCSS Sbjct: 164 PLKNAVCHGSISSPSTPGTCSSGIGVGGGGCSS 196
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 150 PYSPWKRRICHSAPP-QGATPPACRRGGGCSSR 55 P P KRR+ HS PP Q ++P RR SS+ Sbjct: 627 PSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSK 659
>PDC2_CANAL (O60035) Protein PDC2| Length = 836 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +3 Query: 72 LLSCKLEGS----PLVEAQNDKFSASMVNRVFCNNNSDDSTLQQLTSDATIEV 218 +L C ++GS P++ + DKF S V N+ DS Q + EV Sbjct: 223 MLGCNIDGSEKLTPIIVGKYDKFDVSKSTHVSLNSMQFDSVSYQTLMNKLTEV 275
>PEPT_STRPM (Q48U99) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 407 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 87 LEGSPLVEAQNDKFSASMVNRVFCNNNSDDSTLQQLTSDATIEVAID 227 ++G PL E Q + FSA+ + F N T + +A +E+AID Sbjct: 199 MDGGPLGELQYETFSAAALEVTFLGRNVHPGTAKDQMINA-LELAID 244
>PEPT_STRP3 (Q8K802) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 407 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 87 LEGSPLVEAQNDKFSASMVNRVFCNNNSDDSTLQQLTSDATIEVAID 227 ++G PL E Q + FSA+ + F N T + +A +E+AID Sbjct: 199 MDGGPLGELQYETFSAAALEVTFLGRNVHPGTAKDQMINA-LELAID 244
>PEPT_STRP1 (Q9A0F4) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 407 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 87 LEGSPLVEAQNDKFSASMVNRVFCNNNSDDSTLQQLTSDATIEVAID 227 ++G PL E Q + FSA+ + F N T + +A +E+AID Sbjct: 199 MDGGPLGELQYETFSAAALEVTFLGRNVHPGTAKDQMINA-LELAID 244
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 150 PYSPWKRRICHSAPPQGATPPACRR 76 P P KRR+ HS PP+ +P +R Sbjct: 646 PSPPPKRRVSHSPPPKQRSPTVTKR 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,221,968 Number of Sequences: 219361 Number of extensions: 575661 Number of successful extensions: 1892 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1890 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
