ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal12g16 |
|---|---|
| Clone Library Name | barley_pub |
>SIX1C_LEIQH (P68723) Insect neurotoxin 1c precursor (Lqh IT1-c) (LqhIT1-c)| Length = 88 Score = 36.2 bits (82), Expect = 0.020 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + HY E G+CC+L CY G D + ++ +SD Sbjct: 46 KVHYAEKGYCCLLSCYCVGLNDDKKVMEISD 76
>SIX1_LEIQU (P19856) Insect toxins 1 and 1' (Insect toxin LqqIT1/LqqIT1')| Length = 70 Score = 35.0 bits (79), Expect = 0.046 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + HY + G+CC+L CY G D + ++ +SD Sbjct: 28 KVHYADKGYCCLLSCYCVGLSDDKKVLEISD 58
>SIX2_ANDAU (P15147) Insect toxin 2 precursor (AaH IT2) (AaHIT2) (AaIT2)| Length = 88 Score = 34.3 bits (77), Expect = 0.078 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + HY + G+CC+L CY G D + ++ +SD Sbjct: 46 KVHYADKGYCCLLSCYCFGLNDDKKVLEISD 76
>SIX1_ANDAU (P01497) Insect toxin 1 precursor (AaH IT1) (AaHIT1) (AaIT1) (AaH| IT) (AaHIT) Length = 88 Score = 34.3 bits (77), Expect = 0.078 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + HY + G+CC+L CY G D + ++ +SD Sbjct: 46 KVHYADKGYCCLLSCYCFGLNDDKKVLEISD 76
>SIX1B_LEIQH (P68722) Insect neurotoxin 1b precursor (Lqh IT1-b) (LqhIT1-b)| Length = 88 Score = 34.3 bits (77), Expect = 0.078 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + HY + G+CC+L CY G D + ++ +SD Sbjct: 46 KVHYADKGYCCLLSCYCFGLNDDKKVLEISD 76
>SIX1D_LEIQH (P68724) Insect neurotoxin 1d precursor (Lqh IT1-d) (LqhIT1-d)| Length = 88 Score = 32.0 bits (71), Expect = 0.39 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + +Y E G+CC L CY G D + ++ +SD Sbjct: 46 KVYYAEKGYCCTLSCYCVGLDDDKKVLDISD 76
>SIX1A_LEIQH (P68721) Insect neurotoxin 1a precursor (Lqh IT1-a) (LqhIT1-a)| Length = 88 Score = 32.0 bits (71), Expect = 0.39 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLS 220 + HY + G+CC+L CY G D + ++ +S Sbjct: 46 KVHYADKGYCCLLSCYCFGLNDDKKVLEIS 75
>GOPC_MOUSE (Q8BH60) Golgi-associated PDZ and coiled-coil motif-containing| protein (PDZ protein interacting specifically with TC10) (PIST) Length = 463 Score = 31.2 bits (69), Expect = 0.66 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +3 Query: 48 EASRVLLDLELHHKGLDAALLLFLKYTDEERSLRGGT---KLAVHVLRICQANIESNLTD 218 +A +V+L+ E+H + L + +S+ G KL+VH + + +E+N T+ Sbjct: 110 QAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSVEDLERELEANKTE 169 Query: 219 QIKVPTLFGLLHLLSSKKAYNNVLLRH 299 ++K L + LL + N L RH Sbjct: 170 KVKEARLEAEVKLLRKE---NEALRRH 193
>SIX1_MESMA (O61668) Excitatory insect selective toxin 1 precursor (BmK IT1)| (BmKIT1) (BmK IT) (BmKIT) (Bm32-VI) Length = 88 Score = 30.8 bits (68), Expect = 0.86 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + +Y G+CC+L CY G D + ++ + D Sbjct: 46 KVYYATSGYCCLLSCYCFGLDDDKAVLKIKD 76
>GLNE_STRCO (Q8CK02) Glutamate-ammonia-ligase adenylyltransferase (EC 2.7.7.42)| ([Glutamate--ammonia-ligase] adenylyltransferase) (Glutamine-synthetase adenylyltransferase) (ATase) Length = 999 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/29 (37%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +3 Query: 129 DEERSLRGGTKLAVHVLRIC-QANIESNL 212 DE +++R T LA H++RIC + +E ++ Sbjct: 233 DEAKAMRAATSLAAHMMRICSETTVEGSI 261
>SIXP_MESMA (O77091) Toxin BmK IT-AP precursor (Insect toxin analgesic peptide)| (Bm33-I) Length = 90 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 309 RTHYGEGGHCCMLFCY*AGEGDQRVLVLLSD 217 + +Y + G+CC+L CY G D + ++ + D Sbjct: 46 KVYYADKGYCCLLKCYCFGLADDKPVLDIWD 76
>RECR_GEOSL (Q74GZ7) Recombination protein recR| Length = 197 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 221 LISKVRF-NICLAYAQDMNSQLCSTSQRSFFICIFQEQQE 105 ++S+VRF ++C +D + CS ++ IC+ +E Q+ Sbjct: 50 VMSRVRFCSVCFGITEDDPCRFCSDARDDGAICVVEEPQD 89
>ADAS_TRYBB (O97157) Alkyldihydroxyacetonephosphate synthase (EC 2.5.1.26)| (Alkyl-DHAP synthase) (Alkylglycerone-phosphate synthase) Length = 613 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 12/50 (24%) Frame = -3 Query: 345 CWRAFQQQFAKCRTHYGE----GGH--------CCMLFCY*AGEGDQRVL 232 CWRA ++ FA+ G+ G H CC+ F + G+ D+ L Sbjct: 462 CWRAVKKSFAEVMAENGKNAWIGCHTAHQYRFGCCLYFTFIGGQADENDL 511
>GCSPA_SULSO (Q97ZI8) Probable glycine dehydrogenase [decarboxylating] subunit 1| (EC 1.4.4.2) (Glycine decarboxylase subunit 1) (Glycine cleavage system P-protein subunit 1) Length = 455 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 132 EERSLRGGTKLAVHVLRICQANIESNLTDQIKVPTL 239 +ER L+GG KL++H C + + + V T+ Sbjct: 410 KERKLQGGLKLSIHTSLFCVTEVHDKKSIDLLVSTI 445
>CBS2_YEAST (P14905) Cytochrome B translational activator protein CBS2| Length = 389 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -3 Query: 156 FHLAKIFLHLYISRTTRELHLALYGEAQDQEEPC*LLFXLCHGLSMLRKG 7 FH+AKI +S T + L+L G+ Q E+ + L +S LR G Sbjct: 175 FHIAKIDGFPRMSSTGKSASLSLRGDRQKNEKENNAFYKLFREISRLRSG 224
>YFDI_ECOLI (P76507) Hypothetical protein yfdI| Length = 443 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 161 LCSTSQRSFFICIFQEQQESCI*PFMV-KLKIKKNPASFYSXFAMVYPCYGKGQ 3 +CS+S S F +QEQ PF+V L K N + F+++ K Q Sbjct: 133 MCSSSTLSMFASFYQEQIVIIFLPFLVYSLTCKNNKSMLLLFFSLLIISTAKNQ 186
>RP8L1_ARATH (O04093) Putative disease resistance protein RPP8-like protein 1| Length = 821 Score = 27.3 bits (59), Expect = 9.5 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 5/90 (5%) Frame = +3 Query: 3 LPLSVAWINHGKVRIEASRVLLDLELHHKGLDAALLLF-----LKYTDEERSLRGGTKLA 167 L L AWI+H + ++LL L L G+ + L+Y S+ TKL Sbjct: 584 LSLHRAWISHLPSSLRNLKLLLYLNLGFNGMVHVPNVLKEMQELRYLQLPMSMHDKTKLE 643 Query: 168 VHVLRICQANIESNLTDQIKVPTLFGLLHL 257 + L N+ES + K ++ LLH+ Sbjct: 644 LSDL----VNLESLMNFSTKYASVMDLLHM 669
>POL1_TBRVM (Q8B8X3) RNA1 polyprotein (P1) [Contains: P1A protein (1A)| (protease cofactor); Putative ATP-dependent helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (1B) (membrane-binding protein); Viral genome-linked protein (1C-VPg); Picornain 3C-like p Length = 2266 Score = 27.3 bits (59), Expect = 9.5 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = -1 Query: 194 CLAYAQDMNSQLCSTSQRSFFICIFQEQQESCI*PFMVKLKIKKNPASFYS 42 C + + +CS RSF CI Q + E MV++ IKK FYS Sbjct: 444 CEEAGRSLAEGICSVMMRSFRECIAQIKTELGCAIEMVEVMIKKVKDWFYS 494 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,121,895 Number of Sequences: 219361 Number of extensions: 904671 Number of successful extensions: 2060 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2060 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
