| Clone Name | baal12e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPA1_SCHPO (P15398) DNA-directed RNA polymerase I 190 kDa polype... | 33 | 0.36 | 2 | AFF2_HUMAN (P51816) AF4/FMR2 family member 2 (Fragile X mental r... | 30 | 4.0 |
|---|
>RPA1_SCHPO (P15398) DNA-directed RNA polymerase I 190 kDa polypeptide (EC| 2.7.7.6) Length = 1689 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 55 PHEWSSQPENTSETGALISARPVTFTIRTGEAGSAAVAVYNLLAKLQLSFLYVIGLIVMG 234 PH+W +E G LIS P+T RT A NL++ S+ +I Sbjct: 535 PHKWPGASHIQNEDGTLISLMPLTIEQRTALANQLLTPQSNLISS-PYSYSRLINTNKKV 593 Query: 235 FEHMRN 252 + H+RN Sbjct: 594 YRHVRN 599
>AFF2_HUMAN (P51816) AF4/FMR2 family member 2 (Fragile X mental retardation 2| protein) (Protein FMR-2) (FMR2P) (Ox19 protein) (Fragile X E mental retardation syndrome protein) Length = 1311 Score = 29.6 bits (65), Expect = 4.0 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +1 Query: 7 NNALMDLIK--ATKSAVTPHEWSSQPENTSETGALISARPVTFTIRTGEAGSAAVAVYNL 180 + +LM+ K A+K A P W S +NT +L + P+ G + V + Sbjct: 1182 SRSLMEYFKQNASKVAQIPSPWVSNGKNTPSPVSLNNVSPIN---AMGNCNNGPVTIPQR 1238 Query: 181 LAKLQLSFLYVIGLIVMGFEH 243 + + S + + ++ G+EH Sbjct: 1239 IHHMAASHVNITSNVLRGYEH 1259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,269,447 Number of Sequences: 219361 Number of extensions: 1261584 Number of successful extensions: 3223 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3222 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)