| Clone Name | baal11o04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin rece... | 30 | 2.2 | 2 | YBIC_ECOLI (P30178) Hypothetical oxidoreductase ybiC (EC 1.1.1.-) | 28 | 6.5 | 3 | YBIC_ECO57 (P58409) Hypothetical oxidoreductase ybiC (EC 1.1.1.-) | 28 | 6.5 |
|---|
>ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin receptor alpha| subunit) (Integrin alpha-F) (VLA-5) (CD49e antigen) [Contains: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] Length = 1049 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 74 RSSFSWEYGIGYILQRRSAWYEPRGEAIASPRGSYF 181 RS FSW G GY SA + G + GSYF Sbjct: 193 RSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYF 228
>YBIC_ECOLI (P30178) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 118 LKYVTDAILPGKARTTFNKRVPVP 47 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202
>YBIC_ECO57 (P58409) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 118 LKYVTDAILPGKARTTFNKRVPVP 47 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,835,025 Number of Sequences: 219361 Number of extensions: 674892 Number of successful extensions: 1846 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1845 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)