| Clone Name | baal11o02 |
|---|---|
| Clone Library Name | barley_pub |
>WRK31_ARATH (Q93WT0) Probable WRKY transcription factor 31 (WRKY DNA-binding| protein 31) Length = 538 Score = 40.8 bits (94), Expect = 0.003 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 39 PRQPMGLPG--QLSDSVSXXXXXITADPNFTVALAAAISSIMAG 164 P QP+ + +++SVS I +DPNF ALAAAI+SIM G Sbjct: 473 PAQPLQIAATSSVAESVSAASAAIASDPNFAAALAAAITSIMNG 516
>WRK47_ARATH (Q9ZSI7) Probable WRKY transcription factor 47 (WRKY DNA-binding| protein 47) Length = 489 Score = 36.6 bits (83), Expect = 0.053 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +3 Query: 48 PMGLPGQLSDSVSXXXXXITADPNFTVALAAAISSIMAG 164 P P ++ DSV I DPNFT ALAAAIS+I+ G Sbjct: 413 PQAPPREMVDSVRAA---IAMDPNFTAALAAAISNIIGG 448
>WRKY6_ARATH (Q9C519) WRKY transcription factor 6 (WRKY DNA-binding protein 6)| (AtWRKY6) Length = 553 Score = 36.2 bits (82), Expect = 0.070 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 72 SDSVSXXXXXITADPNFTVALAAAISSIMAG 164 S +V+ +TADPNFT ALAA ISS++ G Sbjct: 510 SHAVADTITALTADPNFTAALAAVISSMING 540
>WRK42_ARATH (Q9XEC3) Probable WRKY transcription factor 42 (WRKY DNA-binding| protein 42) Length = 528 Score = 36.2 bits (82), Expect = 0.070 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +3 Query: 39 PRQPMGLPGQLSDSVSXXXXXITADPNFTVALAAAISSIMAGQH 170 P QP+ +SVS I ++PNF ALAAAI+SI+ G + Sbjct: 468 PSQPLNA----GESVSAATAAIASNPNFAAALAAAITSIINGSN 507
>WRK40_ARATH (Q9SAH7) Probable WRKY transcription factor 40 (WRKY DNA-binding| protein 40) Length = 302 Score = 32.0 bits (71), Expect = 1.3 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +3 Query: 9 DSVDAGQFAQPRQPMGLPGQLSDSVSXXXXXITADPNFTVALAAAISSIMAGQH 170 D +++ + P + P V +T DPNFT ALAAA++ + Q+ Sbjct: 245 DMIESKKVTSPTSRIDFPQVQKLLVEQMASSLTKDPNFTAALAAAVTGKLYQQN 298
>WRK61_ARATH (Q8VWV6) Probable WRKY transcription factor 61 (WRKY DNA-binding| protein 61) Length = 480 Score = 30.4 bits (67), Expect = 3.8 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 102 ITADPNFTVALAAAISSIMAG 164 IT DP+F ALA A+SSIM G Sbjct: 443 ITTDPSFQSALATALSSIMGG 463 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,783,337 Number of Sequences: 219361 Number of extensions: 972540 Number of successful extensions: 2549 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2549 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)