| Clone Name | baal11m13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MAD14_ORYSA (Q7Y023) MADS-box transcription factor 14 (OsMADS14)... | 32 | 0.54 | 2 | MAD15_ORYSA (Q6Q9I2) MADS-box transcription factor 15 (OsMADS15)... | 29 | 2.7 | 3 | TPD54_RAT (Q6PCT3) Tumor protein D54 (Tumor protein D52-like 2) | 28 | 7.7 |
|---|
>MAD14_ORYSA (Q7Y023) MADS-box transcription factor 14 (OsMADS14) (Protein| APETALA1-like B) (Protein AGAMOUS-like 10) (FDRMADS6) (RMADS211) Length = 246 Score = 31.6 bits (70), Expect = 0.54 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 3 KLKAKVETIQKCQK 44 KLKAKVETIQKCQK Sbjct: 97 KLKAKVETIQKCQK 110
>MAD15_ORYSA (Q6Q9I2) MADS-box transcription factor 15 (OsMADS15) (Protein| APETALA1-like A) (FDRMADS3) (RMADS215) Length = 267 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 3 KLKAKVETIQKCQK 44 KLKAK+ETIQKC K Sbjct: 97 KLKAKIETIQKCHK 110
>TPD54_RAT (Q6PCT3) Tumor protein D54 (Tumor protein D52-like 2)| Length = 220 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 11/54 (20%) Frame = +3 Query: 171 GVAATGAAXGKLTETYQSQEGS-----------DLNELIQQHNLYKKTRKTLAE 299 G++ G L+ ++ +GS + NE + Q +LYKKT++TL++ Sbjct: 82 GLSTLGELKQNLSRSWHDVQGSTAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQ 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,318,293 Number of Sequences: 219361 Number of extensions: 431473 Number of successful extensions: 816 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)