| Clone Name | baal11d20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1) | 28 | 6.8 | 2 | PURA_ZYMMO (Q5NLU9) Adenylosuccinate synthetase (EC 6.3.4.4) (IM... | 28 | 6.8 | 3 | IRS1_HUMAN (P35568) Insulin receptor substrate 1 (IRS-1) | 28 | 6.8 | 4 | GEA2_YEAST (P39993) ARF guanine-nucleotide exchange factor 2 | 28 | 6.8 |
|---|
>IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1)| Length = 1251 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 Query: 3 AHRHRPMAR**IHPPINIARLI 68 AHRHR AR +HPP+N +R I Sbjct: 356 AHRHRGSAR--LHPPLNHSRSI 375
>PURA_ZYMMO (Q5NLU9) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 27.7 bits (60), Expect = 6.8 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 7/45 (15%) Frame = +1 Query: 7 IVIDPWHGDEFTHRL------ILPD*SAI-DTCMVIIRLSSCMDG 120 +VIDPWH + RL I PD AI +T +I+ L S +DG Sbjct: 71 VVIDPWHFRDEMERLRKQDVVITPDTLAIAETSPLILPLHSELDG 115
>IRS1_HUMAN (P35568) Insulin receptor substrate 1 (IRS-1)| Length = 1242 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 Query: 3 AHRHRPMAR**IHPPINIARLI 68 AHRHR AR +HPP+N +R I Sbjct: 356 AHRHRGSAR--LHPPLNHSRSI 375
>GEA2_YEAST (P39993) ARF guanine-nucleotide exchange factor 2| Length = 1459 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/84 (20%), Positives = 42/84 (50%) Frame = -2 Query: 384 ESIKQAQVLQHFLVIATSVI*SVKITYYSSTQLDXXXXXXXXXXXSTLNPEAAAVRRPLK 205 E+ + +++ L+ S++ + ++++ST ++ ++N A + L Sbjct: 450 ENKNKPSIIKELLIEQISILWTRSPSFFTSTFINFDCNLDRADV--SINFLKALTKLALP 507 Query: 204 HSSTITVENNPAICRQGLIIMVNN 133 S+ T E+ P IC +GL+ +V++ Sbjct: 508 ESALTTTESVPPICLEGLVSLVDD 531 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,926,432 Number of Sequences: 219361 Number of extensions: 994966 Number of successful extensions: 2004 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2004 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)