| Clone Name | baal11b15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KI20A_MOUSE (P97329) Kinesin family member 20A (Rabkinesin-6) (R... | 30 | 2.5 | 2 | KI20A_HUMAN (O95235) Kinesin family member 20A (Rabkinesin-6) (R... | 30 | 2.5 | 3 | PAX1_HUMAN (P15863) Paired box protein Pax-1 (HUP48) | 28 | 5.5 | 4 | PAX1_MOUSE (P09084) Paired box protein Pax-1 | 28 | 5.5 |
|---|
>KI20A_MOUSE (P97329) Kinesin family member 20A (Rabkinesin-6) (Rab6-interacting| kinesin-like protein) (Kinesin-like protein 174) Length = 887 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 11 SAFHSFXDLKALHVQNVGDVVPLYPPLGYVDVA 109 S HS ++ LH+Q GD+VP L D+A Sbjct: 377 SRSHSIFSIRILHLQGEGDIVPKISELSLCDLA 409
>KI20A_HUMAN (O95235) Kinesin family member 20A (Rabkinesin-6) (Rab6-interacting| kinesin-like protein) (GG10_2) Length = 890 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 11 SAFHSFXDLKALHVQNVGDVVPLYPPLGYVDVA 109 S HS ++ LH+Q GD+VP L D+A Sbjct: 378 SRSHSIFSIRILHLQGEGDIVPKISELSLCDLA 410
>PAX1_HUMAN (P15863) Paired box protein Pax-1 (HUP48)| Length = 440 Score = 28.5 bits (62), Expect = 5.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 109 GHVHVPQRWVQGHDVANVL 53 GHV +P+ W H V+N+L Sbjct: 184 GHVSIPRSWPSAHSVSNIL 202
>PAX1_MOUSE (P09084) Paired box protein Pax-1| Length = 361 Score = 28.5 bits (62), Expect = 5.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 109 GHVHVPQRWVQGHDVANVL 53 GHV +P+ W H V+N+L Sbjct: 184 GHVSIPRSWPSAHSVSNIL 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,546,736 Number of Sequences: 219361 Number of extensions: 191714 Number of successful extensions: 797 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 80,573,946 effective HSP length: 14 effective length of database: 77,502,892 effective search space used: 1860069408 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)