| Clone Name | baal11a19 |
|---|---|
| Clone Library Name | barley_pub |
>LBD2_ARATH (Q9LNB9) Putative LOB domain protein 2| Length = 205 Score = 32.7 bits (73), Expect = 0.37 Identities = 17/66 (25%), Positives = 36/66 (54%), Gaps = 5/66 (7%) Frame = -1 Query: 415 QVYSLSS--KLSVATRRVDRSRMSESMLCMSLWNGWIPIVMSFA---RVCSSFSIDKGKL 251 +V+ +S+ K+ R DR+++S+S+ +LW P++ S+ R+C + K + Sbjct: 57 KVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKLYKSLV 116 Query: 250 QQQPVL 233 QP++ Sbjct: 117 HNQPLI 122
>KR171_HUMAN (Q9BYP8) Keratin-associated protein 17-1 (Keratin associated| protein 16.1) Length = 105 Score = 27.7 bits (60), Expect(2) = 0.93 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 17 GGRVAGFNNCGAITGMSCIASSMGLPCCSSG 109 G G CG G C +S G CC SG Sbjct: 59 GSGCGGCGGCGGCGGGCCGSSCCGSSCCGSG 89 Score = 22.7 bits (47), Expect(2) = 0.93 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 225 SCCSTGCC 248 SCC +GCC Sbjct: 84 SCCGSGCC 91
>ARO1_SCHPO (Q9P7R0) Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate| synthase (EC 4.2.3.4); 3-dehydroquinate dehydratase (EC 4.2.1.10) (3-dehydroquinase); Shikimate dehydrogenase (EC 1.1.1.25); Shikimate kinase (EC 2.7.1.71); 3-phosphoshikima Length = 1573 Score = 30.0 bits (66), Expect = 2.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 159 WLHVRRRWSWSQPHGWRPELQQGRPIEEAIQLI 61 W + WSW++PH W +++ + I+L+ Sbjct: 1181 WHDLSGTWSWARPHEWMQKVELASSYADVIKLV 1213
>KI13B_HUMAN (Q9NQT8) Kinesin-like protein KIF13B (Kinesin-like protein GAKIN)| Length = 1826 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 150 VRRRWSWSQPHGWRPELQQGRPIEEAIQLIPVIAPQLLNPATL 22 V+ SW P+L +G P++E + LI + QL +PA + Sbjct: 1221 VKAEASWDSAVHGCPQLSRGTPVDERLFLIVRVTVQLSHPADM 1263
>KR511_HUMAN (Q6L8G4) Keratin-associated protein 5-11 (Keratin-associated| protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11) Length = 156 Score = 26.9 bits (58), Expect(2) = 4.8 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 11 SVGGRVAGFNNCGAITG----MSCIASSMGLPCCSS 106 S GG G +CG+ G C S+ PCCSS Sbjct: 59 SCGGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSS 94 Score = 20.8 bits (42), Expect(2) = 4.8 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +3 Query: 213 YTADSCCSTGCCC 251 + S CS CCC Sbjct: 100 FCCQSSCSKPCCC 112
>TRPV5_RABIT (Q9XSM3) Transient receptor potential cation channel subfamily V| member 5 (TrpV5) (osm-9-like TRP channel 3) (OTRPC3) (Epithelial calcium channel 1) (ECaC1) Length = 730 Score = 28.9 bits (63), Expect = 5.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 207 SYYTADSCCSTGCCCNLPLSMEKEEHTRAKDITI 308 S Y C T CC PL + + T +DITI Sbjct: 334 SLYILYMICFTTCCIYRPLKLRDDNRTDPRDITI 367
>PSTA_DICDI (P11976) Prestalk protein precursor| Length = 1046 Score = 28.5 bits (62), Expect = 7.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 180 HRERNS*NFSYYTADSCCSTGC 245 H N + ++ T DSCCSTGC Sbjct: 957 HTPMNCDDGNFCTLDSCCSTGC 978
>TFF2_PIG (P01359) Trefoil factor 2 precursor (Spasmolytic polypeptide) (SP)| (Pancreatic spasmolytic polypeptide) (PSP) (Fragment) Length = 127 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 102 APGAIRGVGSSSSAGEREATASRRRKHRERNS*N--FSYYTADSCCSTGCC 248 APG G+ G ++ A R + +N N F T+D C ++GCC Sbjct: 6 APGHPPPAGAVCLTGAQKPAACRCSRQDPKNRVNCGFPGITSDQCFTSGCC 56
>FTSB_NEIMB (P64161) Cell division protein ftsB homolog| Length = 92 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 316 WIPIVMSFARVCSSFSI--DKGKLQQQPVLQQLSAV 215 W+ +V+SFA VC +S+ KG + + L++ AV Sbjct: 3 WVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAV 38
>FTSB_NEIMA (P64160) Cell division protein ftsB homolog| Length = 92 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 316 WIPIVMSFARVCSSFSI--DKGKLQQQPVLQQLSAV 215 W+ +V+SFA VC +S+ KG + + L++ AV Sbjct: 3 WVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAV 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,081,505 Number of Sequences: 219361 Number of extensions: 986750 Number of successful extensions: 3261 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3250 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)