ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baak15b03 |
|---|---|
| Clone Library Name | barley_pub |
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLHTTIFDTF 75 TGKGPLNNWATHLSDPLHTTI DTF Sbjct: 260 TGKGPLNNWATHLSDPLHTTIIDTF 284
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLHTTIFDTF 75 TGKGPLNNWATHLSDPLHTTI DTF Sbjct: 263 TGKGPLNNWATHLSDPLHTTIIDTF 287
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 37.4 bits (85), Expect = 0.012 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLHTTIFDTF 75 TGKGP N HLSDP H TI TF Sbjct: 226 TGKGPFENLLQHLSDPWHNTIVQTF 250
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 34.3 bits (77), Expect = 0.100 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLHTTIFDTF 75 TG GP++N HL+DP H TIF F Sbjct: 243 TGTGPIDNLFAHLADPGHATIFAAF 267
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 34.3 bits (77), Expect = 0.100 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLHTTIFDTF 75 TG GP++N HL+DP H TIF F Sbjct: 243 TGTGPIDNLFAHLADPGHATIFAAF 267
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 33.1 bits (74), Expect = 0.22 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 4 GKGPLNNWATHLSDPLHTTIFD 69 G GPL N ATHL+DP H I D Sbjct: 215 GTGPLENLATHLADPWHNNIGD 236
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 32.0 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HLSDP++ Sbjct: 237 TGKGPLENLADHLSDPVN 254
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 31.6 bits (70), Expect = 0.65 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 2 PARVRSTTGPPTSATRCTPPSSTPSAPL 85 P+ +T PPT+ T PP++TPS P+ Sbjct: 1477 PSPPTTTPSPPTTTTTTPPPTTTPSPPM 1504 Score = 30.4 bits (67), Expect = 1.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 17 STTGPPTSATRCTPPSSTPSAPL 85 +T PPT+ T PP++TPS P+ Sbjct: 1420 TTPSPPTTTTTTPPPTTTPSPPI 1442 Score = 29.6 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 17 STTGPPTSATRCTPPSSTPSAP 82 +T PPT+ T PP++TPS P Sbjct: 1600 TTPSPPTTTTTTPPPTTTPSPP 1621 Score = 29.6 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 17 STTGPPTSATRCTPPSSTPSAP 82 +T PPT+ T PP++TPS P Sbjct: 1521 TTPSPPTTTTTTPPPTTTPSPP 1542 Score = 28.9 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 17 STTGPPTSATRCTPPSSTPSAPL 85 +T PP + T PP++TPS+P+ Sbjct: 1663 TTPSPPITTTTTPPPTTTPSSPI 1685 Score = 28.5 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 17 STTGPPTSATRCTPPSSTPSAP 82 +T PPT T PP++TPS P Sbjct: 1584 TTPSPPTITTTTPPPTTTPSPP 1605 Score = 28.5 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 17 STTGPPTSATRCTPPSSTPSAP 82 +T PP S T PP++TPS P Sbjct: 1452 TTPSPPISTTTTPPPTTTPSPP 1473 Score = 28.5 bits (62), Expect = 5.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 2 PARVRSTTGPPTSATRCTPPSSTPSAP 82 P+ +T PP + T PP++TPS P Sbjct: 1399 PSPPTTTPSPPPTTTTTLPPTTTPSPP 1425
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 31.2 bits (69), Expect = 0.84 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLHTTIFD 69 TGKGPL N A HL+DP++ ++ Sbjct: 236 TGKGPLENLADHLADPVNNNAWN 258
>CB2D_LYCES (P10707) Chlorophyll a-b binding protein 1D (LHCII type I CAB-1D)| (LHCP) (Fragment) Length = 116 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 85 TGKGPLENLADHLADPVN 102
>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor| (LHCII type I CAB-1C) (LHCP) (Fragments) Length = 265 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 234 TGKGPLENLADHLADPVN 251
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 234 TGKGPLENLADHLADPVN 251
>CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type I CAB-1A) (LHCP) (Fragments) Length = 265 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 234 TGKGPLENLADHLADPVN 251
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 234 TGKGPLENLADHLADPVN 251
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 235 TGKGPLENLADHLADPVN 252
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 235 TGKGPLENLADHLADPVN 252
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 233 TGKGPLENLADHLADPVN 250
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 234 TGKGPLENLADHLADPVN 251
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 233 TGKGPLENLADHLADPVN 250
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 235 TGKGPLENLADHLADPVN 252
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 235 TGKGPLENLADHLADPVN 252
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 235 TGKGPLENLADHLADPVN 252
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 234 TGKGPLENLADHLADPVN 251
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 225 TGKGPLENLADHLADPVN 242
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 238 TGKGPLENLADHLADPVN 255
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 175 TGKGPLENLADHLADPVN 192
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 230 TGKGPLENLADHLADPVN 247
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 197 TGKGPLENLADHLADPVN 214
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 236 TGKGPLENLADHLADPVN 253
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 236 TGKGPLENLADHLADPVN 253
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 236 TGKGPLENLADHLADPVN 253
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 236 TGKGPLENLADHLADPVN 253
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 236 TGKGPLENLADHLADPVN 253
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 236 TGKGPLENLADHLADPVN 253
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 224 TGKGPLENLADHLADPVN 241
>CB21_RAPSA (P14584) Chlorophyll a-b binding of LHCII type 1 protein| (Chlorophyll a-b binding of LHCII type I protein) (CAB) (LHCP) (Fragment) Length = 124 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+DP++ Sbjct: 93 TGKGPLENLADHLADPVN 110
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGP+ N A HL+DP++ Sbjct: 243 TGKGPIENLADHLADPVN 260
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A H++DP++ Sbjct: 234 TGKGPLENLADHIADPVN 251
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGP+ N A HL+DP++ Sbjct: 233 TGKGPIENLADHLTDPVN 250
>CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloroplast precursor| (LHCII type I CAB-3B) (LHCP) (Fragments) Length = 267 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A H++DP++ Sbjct: 236 TGKGPLENLADHIADPVN 253
>CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloroplast precursor| (LHCII type I CAB-3A) (LHCP) (Fragments) Length = 267 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A H++DP++ Sbjct: 236 TGKGPLENLADHIADPVN 253
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGP+ N A HL+DP++ Sbjct: 236 TGKGPIENLADHLADPVN 253
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGP+ N A HL+DP++ Sbjct: 236 TGKGPIENLADHLADPVN 253
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGP+ N A HL+DP++ Sbjct: 247 TGKGPIENLADHLADPVN 264
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGP+ N A HL+DP++ Sbjct: 247 TGKGPIENLADHLADPVN 264
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A H++DP++ Sbjct: 231 TGKGPLENLADHIADPVN 248
>CB21_EUGGR (P12327) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 127 Score = 29.6 bits (65), Expect = 2.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 1 TGKGPLNNWATHLSDP 48 TG+GP+ NW HL DP Sbjct: 91 TGEGPVENWLYHLQDP 106
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 29.6 bits (65), Expect = 2.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL+N HL+DP++ Sbjct: 236 TGKGPLDNLVDHLADPVN 253
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 29.6 bits (65), Expect = 2.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL DP++ Sbjct: 236 TGKGPLENLADHLVDPVN 253
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 29.3 bits (64), Expect = 3.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 1 TGKGPLNNWATHLSDP 48 TGKGP+ N A HL+DP Sbjct: 225 TGKGPIQNLADHLADP 240
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 29.3 bits (64), Expect = 3.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL++P++ Sbjct: 214 TGKGPLENLADHLAEPVN 231
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 28.9 bits (63), Expect = 4.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPL 51 TGKGP+ N A H++DP+ Sbjct: 233 TGKGPIENLADHIADPV 249
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 28.5 bits (62), Expect = 5.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 1 TGKGPLNNWATHLSDP 48 TG+GP+ N A HLSDP Sbjct: 246 TGEGPVENLAKHLSDP 261
>LATS1_MOUSE (Q8BYR2) Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large| tumor suppressor homolog 1) (WARTS protein kinase) Length = 1129 Score = 28.5 bits (62), Expect = 5.5 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 2 PARVRSTTGPPTSATRCTPPSSTPSAPLKWSVVEQ 106 P +VRS T PP + PP T P W Q Sbjct: 239 PPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPSSQ 273
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 1 TGKGPLNNWATHLSDP 48 TGKGP+ N + HL+DP Sbjct: 234 TGKGPIENLSDHLADP 249
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL + A H++DP++ Sbjct: 235 TGKGPLEDLADHIADPVN 252
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 28.1 bits (61), Expect = 7.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPL 51 TGKGPL N HL+DP+ Sbjct: 237 TGKGPLENLNDHLADPV 253
>LATS1_HUMAN (O95835) Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large| tumor suppressor homolog 1) (WARTS protein kinase) (h-warts) Length = 1130 Score = 28.1 bits (61), Expect = 7.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 2 PARVRSTTGPPTSATRCTPPSSTPSAPLKW 91 P +VRS T PP + PP T P W Sbjct: 239 PPQVRSVTPPPPPRGQTPPPRGTTPPPPSW 268
>RHG06_HUMAN (O43182) Rho-GTPase-activating protein 6 (Rho-type| GTPase-activating protein RhoGAPX-1) Length = 974 Score = 28.1 bits (61), Expect = 7.1 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Frame = +2 Query: 2 PARVRSTTGPPTSATRCTPPS------STPSAP 82 P S+ GPP ATR PP STPS P Sbjct: 77 PRLASSSRGPPPRATRLPPPGPLCSSFSTPSTP 109
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 28.1 bits (61), Expect = 7.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPLH 54 TGKGPL N A HL+ P++ Sbjct: 232 TGKGPLENLADHLAGPVN 249
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 27.7 bits (60), Expect = 9.3 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPL 51 TGKGP+ N + H++DP+ Sbjct: 234 TGKGPIENLSDHINDPV 250
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 27.7 bits (60), Expect = 9.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPL 51 TGKGPL N HL DP+ Sbjct: 237 TGKGPLENLFDHLDDPV 253
>SGS3_DROER (P13730) Salivary glue protein Sgs-3 precursor| Length = 328 Score = 27.7 bits (60), Expect = 9.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 5 ARVRSTTGPPTSATRCTPPSSTPSAP 82 A V +TT P + TRC PP++T P Sbjct: 45 APVTTTTCRPPTTTRCPPPTTTRCPP 70
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 27.7 bits (60), Expect = 9.3 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 1 TGKGPLNNWATHLSDPL 51 TGKGP+ N + H++DP+ Sbjct: 206 TGKGPIENLSDHIADPV 222 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,679,474 Number of Sequences: 219361 Number of extensions: 150136 Number of successful extensions: 1382 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1376 length of database: 80,573,946 effective HSP length: 15 effective length of database: 77,283,531 effective search space used: 1854804744 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
