| Clone Name | bags39j03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PUR5_VIBCH (Q9KPY6) Phosphoribosylformylglycinamidine cyclo-liga... | 28 | 8.7 | 2 | PUR5_PHOLL (Q7N3F7) Phosphoribosylformylglycinamidine cyclo-liga... | 28 | 8.7 |
|---|
>PUR5_VIBCH (Q9KPY6) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 346 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 78 DFDTSGN--DTVEEDEFVAGMKIWLHEAKSKVAASGAYSN 191 D+D +G VE++E + G K+ + +A V +SG +SN Sbjct: 154 DYDVAGFCVGVVEKEEIIDGSKVQVGDALIAVGSSGPHSN 193
>PUR5_PHOLL (Q7N3F7) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 346 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +3 Query: 78 DFDTSGN--DTVEEDEFVAGMKIWLHEAKSKVAASGAYSN 191 D+D +G VE+ E + G K+ +A +AASG +SN Sbjct: 153 DYDVAGFCVGVVEKSEIIDGSKVQAGDALIALAASGPHSN 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,881,745 Number of Sequences: 219361 Number of extensions: 276607 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)