| Clone Name | bags38n08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STIP_SOYBN (Q43468) Heat shock protein STI (Stress-inducible pro... | 29 | 3.0 | 2 | CP4C1_BLADI (P29981) Cytochrome P450 4C1 (EC 1.14.14.1) (CYPIVC1) | 28 | 6.6 | 3 | IBMP_CAMVB (P16666) Inclusion body matrix protein (Viroplasmin) | 28 | 6.6 | 4 | CYAA_PODAN (Q01513) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophos... | 28 | 8.6 |
|---|
>STIP_SOYBN (Q43468) Heat shock protein STI (Stress-inducible protein) (GmSTI)| Length = 569 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 87 NEQPDILRPLYSALQPSSSLEEIRYYDSRLSDQ 185 N PD L+ L A + LE+ Y+D +L+D+ Sbjct: 351 NRNPDTLKKLNEAEKAKKELEQQEYFDPKLADE 383
>CP4C1_BLADI (P29981) Cytochrome P450 4C1 (EC 1.14.14.1) (CYPIVC1)| Length = 511 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 24 VISAGCFMSLYIGHIHKYNSLNEQPDILRP 113 ++ AGC M+L I H+H+ P+ P Sbjct: 397 LVPAGCMMNLQIYHVHRNQDQYPNPEAFNP 426
>IBMP_CAMVB (P16666) Inclusion body matrix protein (Viroplasmin)| Length = 522 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 5/37 (13%) Frame = +3 Query: 87 NEQPDILRPLYSA-----LQPSSSLEEIRYYDSRLSD 182 N P+++R Y+A + PS++L+EI+Y ++ D Sbjct: 287 NANPEMIREAYNAGLIRTIYPSNNLQEIKYLPKKVKD 323
>CYAA_PODAN (Q01513) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2145 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 60 GHIHKYNSLNEQPDILRPLYSALQPSSSLEEIR 158 GH H++N NE P LRP S + S+ + R Sbjct: 370 GHHHRHNKSNEDPRSLRPTVSREDSTISVPKDR 402 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,568,384 Number of Sequences: 219361 Number of extensions: 393365 Number of successful extensions: 903 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)