ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags37o11 |
|---|---|
| Clone Library Name | barley_pub |
>APX1_ORYSA (P93404) L-ascorbate peroxidase 1, cytosolic (EC 1.11.1.11) (APXa)| Length = 249 Score = 95.5 bits (236), Expect = 3e-20 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAEA 159 K GLLQLPSDK LL+DP FRPLVEKYAADEKAFFEDYKEAHL+LSELG+A+A Sbjct: 198 KEGLLQLPSDKALLSDPAFRPLVEKYAADEKAFFEDYKEAHLKLSELGFADA 249
>APX1_PEA (P48534) L-ascorbate peroxidase, cytosolic (EC 1.11.1.11) (AP)| Length = 249 Score = 88.2 bits (217), Expect = 4e-18 Identities = 43/52 (82%), Positives = 45/52 (86%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAEA 159 K GLLQLPSDK LLTD VFRPLVEKYAADE FF DY EAHL+LSELG+AEA Sbjct: 198 KDGLLQLPSDKALLTDSVFRPLVEKYAADEDVFFADYAEAHLKLSELGFAEA 249
>APX2_ORYSA (Q9FE01) L-ascorbate peroxidase 2, cytosolic (EC 1.11.1.11) (APXb)| Length = 251 Score = 87.0 bits (214), Expect = 9e-18 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAE 156 K GLLQLPSDK L+ DP FRPLVEKYAADE AFF DY EAHL+LSELG+AE Sbjct: 200 KEGLLQLPSDKALMADPAFRPLVEKYAADEDAFFADYAEAHLKLSELGFAE 250
>APX1_ARATH (Q05431) L-ascorbate peroxidase, cytosolic (EC 1.11.1.11) (AP)| Length = 249 Score = 85.1 bits (209), Expect = 4e-17 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAEA 159 K GLLQL SDK LL DPVFRPLVEKYAADE AFF DY EAH++LSELG+A+A Sbjct: 198 KEGLLQLVSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHMKLSELGFADA 249
>APX3_ORYSA (Q6TY83) Putative L-ascorbate peroxidase 3 (EC 1.11.1.11)| Length = 291 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGY 150 GLL+LP+DK L+ DP FR VE YA DE AFF DY E+H +LSELG+ Sbjct: 199 GLLKLPTDKALVEDPTFRRYVELYAKDEDAFFRDYAESHKKLSELGF 245
>APX4_ORYSA (Q6ZJJ1) Putative L-ascorbate peroxidase 4 (EC 1.11.1.11)| Length = 291 Score = 63.5 bits (153), Expect = 1e-10 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGY 150 GLL+LP+DK LL DP FR V+ YA DE FF+DY E+H +LSELG+ Sbjct: 198 GLLKLPTDKALLEDPSFRRYVDLYARDEDTFFKDYAESHKKLSELGF 244
>APX8_ORYSA (Q69SV0) Probable L-ascorbate peroxidase 8, chloroplast precursor| (EC 1.11.1.11) Length = 478 Score = 57.8 bits (138), Expect = 6e-09 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 LL LP+D L DP F+ EKYA D++AFF+DY EAH +LS+LG Sbjct: 301 LLVLPTDAALFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSDLG 345
>APX6_ORYSA (P0C0L1) Probable L-ascorbate peroxidase 6, chloroplast precursor| (EC 1.11.1.11) Length = 309 Score = 56.2 bits (134), Expect = 2e-08 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 LL LP+D L D F+ EKYAAD+ AFFEDY EAH +LS LG Sbjct: 253 LLVLPTDAVLFEDSSFKIYAEKYAADQDAFFEDYAEAHAKLSNLG 297
>APX7_ORYSA (Q7XJ02) Probable L-ascorbate peroxidase 7, chloroplast precursor| (EC 1.11.1.11) Length = 359 Score = 55.1 bits (131), Expect = 4e-08 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 LL LP+D L DP F+ EKYA D++AFF+DY AH +LS LG Sbjct: 302 LLVLPTDAALFEDPTFKVYAEKYAEDQEAFFKDYAGAHAKLSNLG 346
>CCPR2_CRYNE (Q5KGE6) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 315 Score = 54.7 bits (130), Expect = 5e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D L+ DP FRP VEKYAAD+ FF+D+ A +L ELG Sbjct: 206 LMMLPTDMALIEDPSFRPWVEKYAADQNLFFKDFANAFGKLIELG 250
>APX5_ORYSA (P0C0L0) Probable L-ascorbate peroxidase 5, chloroplast precursor| (EC 1.11.1.11) Length = 320 Score = 53.5 bits (127), Expect = 1e-07 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 LL LP+D L D F+ EKYA D+ AFFEDY EAH +LS LG Sbjct: 264 LLVLPTDAVLFEDSSFKIHAEKYAEDQDAFFEDYAEAHAKLSNLG 308
>CCPR_GIBZE (Q4ING3) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 358 Score = 52.0 bits (123), Expect = 3e-07 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LPSD L+ D F+P VEKYA D AFF+D+ LRL ELG Sbjct: 294 LMMLPSDIALIEDKKFKPWVEKYAKDNDAFFKDFSNVVLRLFELG 338
>CCPR2_ASPFU (Q4WLG9) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 322 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D L TDP FR V+KYAAD+ FF+ + +A +L ELG Sbjct: 224 LMMLPTDIALKTDPAFRVWVDKYAADKDLFFDHFAKAFAKLMELG 268
>CCPR2_EMENI (Q5B1Z0) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 312 Score = 49.3 bits (116), Expect = 2e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D L DP FRP VE+YA D+ FF+ + +A +L ELG Sbjct: 224 LMMLPTDVALRDDPAFRPWVERYAKDKDLFFDHFSKAFAKLIELG 268
>CCPR2_YARLI (Q6CAB5) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 285 Score = 48.5 bits (114), Expect = 4e-06 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D +L+ DP F VE YAAD++ FFED+ + +L ELG Sbjct: 216 LMMLPADYSLMQDPEFHKWVEIYAADKEKFFEDFSKVFAKLIELG 260
>CCPR_NEUCR (Q7SDV9) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 358 Score = 48.1 bits (113), Expect = 5e-06 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG--YAEA*ER 168 L+ LP+D L+ D F+ VEKYAAD + FF+D+ ++L ELG +AE ER Sbjct: 297 LMMLPADMALIQDKKFKQWVEKYAADNELFFKDFSNVIVKLFELGVPFAENSER 350
>CCPR_ASPFU (Q4WPF8) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 366 Score = 47.4 bits (111), Expect = 8e-06 Identities = 21/45 (46%), Positives = 31/45 (68%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D L+ D F+ VE+YA D AFF+D+ +A ++L ELG Sbjct: 305 LMMLPADLALIKDKEFKKHVERYARDSDAFFKDFSDAFVKLLELG 349
>CCPR2_USTMA (Q4PD66) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 330 Score = 47.4 bits (111), Expect = 8e-06 Identities = 22/45 (48%), Positives = 28/45 (62%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D L+ D RP VEKYA D AFF D+ + +L ELG Sbjct: 223 LMMLPTDYALIQDEKMRPWVEKYAEDRDAFFNDFAKVFAKLIELG 267
>CCPR2_GIBZE (Q4HWQ2) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 331 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/47 (46%), Positives = 30/47 (63%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYA 153 L+ LP+D L TD F V+ YA D+ FF+D+K+A +L ELG A Sbjct: 234 LMMLPTDIALTTDSEFSKYVQLYAKDKDVFFQDFKKAFAKLLELGIA 280
>CCPR_YEAST (P00431) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 361 Score = 44.7 bits (104), Expect = 5e-05 Identities = 19/49 (38%), Positives = 33/49 (67%) Frame = +1 Query: 1 AKXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 +K G + LP+D +L+ DP + +V++YA D+ FF+D+ +A +L E G Sbjct: 292 SKSGYMMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENG 340
>CCPR_EMENI (P0C0V3) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 361 Score = 44.3 bits (103), Expect = 7e-05 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ P+D L+ D FR VE+YA D AFF+++ E ++L ELG Sbjct: 300 LMMFPTDLALVQDKGFRKHVERYAKDSDAFFKEFSEVFVKLLELG 344
>PER41_ARATH (O23609) Peroxidase 41 precursor (EC 1.11.1.7) (Atperox P41)| Length = 326 Score = 43.9 bits (102), Expect = 9e-05 Identities = 23/48 (47%), Positives = 28/48 (58%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 K GL L SD L DP RP VE YA ++ AFFED+ A +L +G Sbjct: 258 KRGLGLLASDHILFKDPSTRPFVELYANNQTAFFEDFARAMEKLGRVG 305
>CCPR_USTMA (Q4PBY6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 398 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ L +D L+ DP F+ V++YA E FF D++ A+ +L ELG Sbjct: 323 LMMLMTDMALVQDPSFKKHVQRYAKSEDEFFNDFRSAYAKLLELG 367
>CCPR_CRYNE (Q5KIK5) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 377 Score = 43.5 bits (101), Expect = 1e-04 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAE 156 L+ LP+D LL D F+ V+ YA +E+ FF D+ +A +L ELG E Sbjct: 316 LMMLPTDMALLKDKSFKKYVDIYADNEEKFFSDFAKAFSKLIELGVPE 363
>CCPR_CANGA (Q6FMG7) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 357 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 G + LP+D L+ D + +V++YAAD+ AFF D+ +A L E G Sbjct: 292 GYMMLPTDYALIQDSNYLKIVKEYAADQDAFFRDFSKAFAALLERG 337
>CCPR_CRYNV (Q6URB0) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 377 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAE 156 L+ LP+D L+ D F+ V+ YA +E+ FF D+ +A +L ELG E Sbjct: 316 LMMLPTDMALVKDKSFKKYVDIYADNEEKFFSDFAKAFSKLIELGVPE 363
>CCPR_KLULA (Q6CW24) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 346 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/46 (36%), Positives = 31/46 (67%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 G + LP+D L+ DP + P+V+++A D+ FF+++ +A + L E G Sbjct: 281 GWMMLPTDMALVQDPKYLPIVKEFANDQDTFFKEFTKAFVVLLENG 326
>PER40_ARATH (O23474) Peroxidase 40 precursor (EC 1.11.1.7) (Atperox P40)| Length = 348 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/39 (48%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 22 LPSDKTL-LTDPVFRPLVEKYAADEKAFFEDYKEAHLRL 135 LPSD+ L + DP R +VE YA D+ FFED+K A +++ Sbjct: 291 LPSDQALAVQDPGTRAIVETYATDQSVFFEDFKNAMVKM 329
>PER65_ARATH (Q9FJR1) Peroxidase 65 precursor (EC 1.11.1.7) (Atperox P65)| (ATP43) Length = 334 Score = 40.4 bits (93), Expect = 0.001 Identities = 21/48 (43%), Positives = 28/48 (58%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 K GL L SD L+ D +P V+ YA +E AFFED+ A +L +G Sbjct: 266 KRGLGLLASDHILIKDNSTKPFVDLYATNETAFFEDFARAMEKLGTVG 313
>PER63_ARATH (Q9FL16) Peroxidase 63 precursor (EC 1.11.1.7) (Atperox P63)| (ATP26a) Length = 328 Score = 39.7 bits (91), Expect = 0.002 Identities = 21/43 (48%), Positives = 25/43 (58%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLS 138 GL L SD L +DP RP VE YA D+ FF D+ A +LS Sbjct: 266 GLGLLESDHGLFSDPRTRPFVELYARDQSRFFNDFAGAMQKLS 308
>CCPR2_CANAL (Q59X94) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 291 Score = 38.1 bits (87), Expect = 0.005 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = +1 Query: 1 AKXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 A L+ L +D L+ D + VE YA DE FF D+ A +L ELG Sbjct: 237 ADKSLIMLNTDMELIRDKSYLHWVEIYAKDEPKFFHDFSSAFAKLLELG 285
>CCPR_DEBHA (Q6BKY9) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 360 Score = 37.4 bits (85), Expect = 0.009 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +1 Query: 16 LQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 + LP+D L D F V+ YA DEK FF D+ + L ELG Sbjct: 297 MMLPTDMALKEDSSFLKYVKMYADDEKLFFSDFAKNFSTLLELG 340
>UC36_MAIZE (P80642) Unknown protein from 2D-PAGE of etiolated coleoptile (Spot| 415) (Fragments) Length = 52 Score = 36.6 bits (83), Expect = 0.015 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +1 Query: 28 SDKTLLTDPVFRPLVEKYAADEKAFFEDY 114 SD+ LL+DPVFRPLV EK FF+DY Sbjct: 22 SDQALLSDPVFRPLV------EKXFFDDY 44
>PER31_ARATH (Q9LHA7) Peroxidase 31 precursor (EC 1.11.1.7) (Atperox P31)| (ATP41) Length = 316 Score = 36.2 bits (82), Expect = 0.019 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 4 KXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 K GL L SD L +DP R V+ YA ++ FF+D+ +A +LS G Sbjct: 252 KKGLGLLESDHGLYSDPRTRYFVDLYAKNQDLFFKDFAKAMQKLSLFG 299
>PER46_ARATH (O81772) Peroxidase 46 precursor (EC 1.11.1.7) (Atperox P46)| (ATP48) Length = 326 Score = 35.8 bits (81), Expect = 0.025 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 GL Q +D L+ D R +VE+ A+DE++FF+ + E+ ++LS +G Sbjct: 266 GLFQ--TDSALMEDNRTRTMVEELASDEESFFQRWSESFVKLSMVG 309
>CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 340 Score = 35.0 bits (79), Expect = 0.043 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ LP+D L TD F+ YA D+ FF+D+ A ++ G Sbjct: 279 LMMLPTDMALATDKNFKKWATAYAKDQDLFFKDFSAAFSKMLNNG 323
>CCPR3_YARLI (Q6C7U1) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 297 Score = 35.0 bits (79), Expect = 0.043 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 G + +PSD +L+ D FR V++YA E+ + + + A +L+ELG Sbjct: 251 GQVMMPSDMSLIEDANFRFWVDQYAVSEELWRDHFALAFEKLTELG 296
>PER66_ARATH (Q9LT91) Peroxidase 66 precursor (EC 1.11.1.7) (Atperox P66)| (ATP27a) Length = 322 Score = 34.7 bits (78), Expect = 0.056 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +1 Query: 28 SDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELGYAE 156 SD+ LL D + +VE +A D+KAFF ++ + ++L G E Sbjct: 268 SDQALLGDSRTKWIVETFAQDQKAFFREFAASMVKLGNFGVKE 310
>CCPR2_DEBHA (Q6BIB1) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 428 Score = 34.7 bits (78), Expect = 0.056 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 13 LLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L+ L +D L+ DP F V+ Y+ + FF+D+ A +L ELG Sbjct: 368 LIMLNTDIELIRDPHFLHFVKLYSQHQATFFQDFANAFGKLLELG 412
>PER71_ARATH (Q43387) Peroxidase 71 precursor (EC 1.11.1.7) (Atperox P71)| (ATP15a) (ATPO2) Length = 328 Score = 34.7 bits (78), Expect = 0.056 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 22 LPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L SD+ L TDP RP+V++ A F ++ + +R+S +G Sbjct: 270 LQSDQVLWTDPATRPIVQQLMAPRSTFNVEFARSMVRMSNIG 311
>PER29_ARATH (Q9LSP0) Peroxidase 29 precursor (EC 1.11.1.7) (Atperox P29)| (ATP40) Length = 339 Score = 33.9 bits (76), Expect = 0.095 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +1 Query: 1 AKXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLS 138 A G L D + DP RP VE +AAD+ FF + A ++LS Sbjct: 274 AIAGRGNLRIDSEIGADPRTRPFVEAFAADQDRFFNAFSSAFVKLS 319
>PER10_ARATH (Q9FX85) Peroxidase 10 precursor (EC 1.11.1.7) (Atperox P10)| (ATP5a) Length = 350 Score = 33.1 bits (74), Expect = 0.16 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 22 LPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 L SD+TL+TDP LV+ Y+ + F D+ + +++ +G Sbjct: 292 LDSDQTLMTDPTAAALVKSYSENPYLFSRDFAVSMVKMGNIG 333
>CCPR_CANAL (Q5AEN1) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 366 Score = 32.0 bits (71), Expect = 0.36 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 16 LQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSELG 147 + LP+D L + F V+ YA D+ FF+D+ +A +L G Sbjct: 302 MMLPTDMALKEESYFLKYVKMYADDQDLFFKDFAKAFSKLISNG 345
>PER17_ARATH (Q9SJZ2) Peroxidase 17 precursor (EC 1.11.1.7) (Atperox P17)| (ATP25a) Length = 329 Score = 31.6 bits (70), Expect = 0.47 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +1 Query: 22 LPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSEL 144 L SD+TL T+ V R V+ ++ D+ FF + E ++L +L Sbjct: 263 LNSDQTLYTNLVTREYVKMFSEDQDEFFRAFAEGMVKLGDL 303
>PER14_ARATH (Q9SI17) Peroxidase 14 precursor (EC 1.11.1.7) (Atperox P14)| Length = 337 Score = 31.6 bits (70), Expect = 0.47 Identities = 15/42 (35%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 22 LPSDKTLLT-DPVFRPLVEKYAADEKAFFEDYKEAHLRLSEL 144 L SD+ L + + R LV+KYA D++ FFE + E+ +++ ++ Sbjct: 276 LNSDQVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGKI 317
>PER15_ARATH (Q9SI16) Peroxidase 15 precursor (EC 1.11.1.7) (Atperox P15)| (ATP36) Length = 338 Score = 31.2 bits (69), Expect = 0.62 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 22 LPSDKTLLT-DPVFRPLVEKYAADEKAFFEDYKEAHLRLSEL 144 L SD+ L + + R LV+KYA D++ FFE + E+ +++ + Sbjct: 277 LNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNI 318
>PER21_ARATH (Q42580) Peroxidase 21 precursor (EC 1.11.1.7) (Atperox P21)| (PRXR5) (ATP2a/ATP2b) Length = 327 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/47 (42%), Positives = 22/47 (46%) Frame = +1 Query: 1 AKXGLLQLPSDKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSE 141 A GLL + D L TDP P V K AAD F E + LSE Sbjct: 264 AHKGLLVI--DDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSE 308
>PER49_ARATH (O23237) Peroxidase 49 precursor (EC 1.11.1.7) (Atperox P49)| (ATP31) Length = 331 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 22 LPSDKTLLT-DPVFRPLVEKYAADEKAFFEDYKEAHLRLSEL 144 L SD+ L + + R LV+KYA D+ FFE + E+ +++ + Sbjct: 271 LNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNI 312
>PER9_ARATH (Q96512) Peroxidase 9 precursor (EC 1.11.1.7) (Atperox P9) (ATP18a)| Length = 346 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 22 LPSDKTLLTDPVFRP--LVEKYAADEKAFFEDYKEAHLRLSEL 144 L SD+ LLT V + LV+ YA DE+ FF+ + ++ + + + Sbjct: 286 LTSDEVLLTGNVGKTGALVKAYAEDERLFFQQFAKSMVNMGNI 328
>PER37_ARATH (Q9LDN9) Peroxidase 37 precursor (EC 1.11.1.7) (Atperox P37)| (ATP38) Length = 346 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFR---PLVEKYAADEKAFFEDYKEAHLRLSEL 144 GL+Q SD+ L + P PLV +YA + FF+ + +A +R+S L Sbjct: 264 GLIQ--SDQELFSSPDASDTLPLVREYADGQGKFFDAFAKAMIRMSSL 309
>PER42_ARATH (Q9SB81) Peroxidase 42 precursor (EC 1.11.1.7) (Atperox P42)| (PRXR1) (ATP1a/ATP1b) Length = 330 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 31 DKTLLTDPVFRPLVEKYAADEKAFFEDYKEAHLRLSE 141 D L D RP+V+K A D+ FF+++ A LSE Sbjct: 272 DHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSE 308
>ORC1_MOUSE (Q9Z1N2) Origin recognition complex subunit 1| Length = 840 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -2 Query: 154 QRTPVRRA*GVPPCSPRRKPSHPQHISPQEG----GRQGQSAEFC 32 Q+T RRA SP +KP+ P+ I P + GQ+ FC Sbjct: 262 QKTSKRRAAFSETTSPPKKPNKPREIKPSSALETRVKNGQTQPFC 306
>GAM1_ORYSA (P93417) Transcription factor GAMYB (OsGAMyb)| Length = 553 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 297 LERCQWFGVPLY--SVCLDAINLSYEMNCSSDF 389 ++RCQ G+P+Y SVC + N + CSSDF Sbjct: 140 IKRCQRAGLPIYPTSVCNQSSN--EDQQCSSDF 170
>PER72_ARATH (Q9FJZ9) Peroxidase 72 precursor (EC 1.11.1.7) (Atperox P72)| (PRXR8) (ATP6a) Length = 336 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 22 LPSDKTLLT-DPVFRPLVEKYAADEKAFFEDYKEAHLRLSEL 144 L SD+ L T + + LVE YA +++AFFE + ++ +++ + Sbjct: 274 LSSDEILFTKNKQSKELVELYAENQEAFFEQFAKSMVKMGNI 315
>RNS10_SHEEP (Q70IB1) Ribonuclease-like protein 10 precursor (Protein Train A)| (Fragment) Length = 161 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 299 KVWPQANKHYYRDDYL-AVCGLTLTPSLDAEQDHP 198 +V Q+NKHY R D + C + P+L + +DHP Sbjct: 96 EVLSQSNKHYLRSDVMDRECNALMAPNLKS-KDHP 129
>PER22_ARATH (P24102) Peroxidase 22 precursor (EC 1.11.1.7) (Atperox P22)| (ATPEa) (Basic peroxidase E) Length = 349 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFR--PLVEKYAADEKAFFEDYKEAHLRLSEL 144 GL+Q SD+ L + P PLV +Y++D FF + +A +R+ L Sbjct: 271 GLIQ--SDQELFSTPGADTIPLVNQYSSDMSVFFRAFIDAMIRMGNL 315
>PER2_ARMRU (P17179) Peroxidase C2 precursor (EC 1.11.1.7)| Length = 347 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFR---PLVEKYAADEKAFFEDYKEAHLRLSEL 144 GL+Q SD+ L + P PLV YA + FF+ + EA +R+ L Sbjct: 266 GLIQ--SDQELFSSPDASDTIPLVRAYADGQGKFFDAFVEAMIRMGNL 311
>LYSC_EQUAS (P11375) Lysozyme C (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C)| Length = 129 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 341 ANRVQRHTKPLTAFKVWPQANKHYYRDDYLAVCGL 237 A RV R K ++A+K W + K +YLA C L Sbjct: 95 AKRVVRDPKGMSAWKAWVKHCKDKDLSEYLASCNL 129
>LYSC1_HORSE (P11376) Lysozyme C, milk isozyme (EC 3.2.1.17)| (1,4-beta-N-acetylmuramidase C) Length = 129 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 341 ANRVQRHTKPLTAFKVWPQANKHYYRDDYLAVCGL 237 A RV R K ++A+K W + K +YLA C L Sbjct: 95 AKRVVRDPKGMSAWKAWVKHCKDKDLSEYLASCNL 129
>XERCL_PSEAE (Q9F771) Tyrosine recombinase xerC-like| Length = 427 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -2 Query: 145 PVRRA*GVPPCSPRRKPSHPQHISPQEGGRQGQSAEFCHLEAEEVP 8 P+ R VPP R +PS P+ + + G ++G ++ EAE VP Sbjct: 338 PLARVGEVPPPEARTEPSEPREHTQETGIQRGPTS----WEAEAVP 379
>PER38_ARATH (Q9LDA4) Peroxidase 38 precursor (EC 1.11.1.7) (Atperox P38)| Length = 346 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +1 Query: 10 GLLQLPSDKTLLTDPVFR---PLVEKYAADEKAFFEDYKEAHLRLSEL 144 GL+Q SD+ L + P PLV YA + FF+ + +A +R+S L Sbjct: 264 GLIQ--SDQELFSSPDAADTLPLVRAYADGQGTFFDAFVKAIIRMSSL 309
>LET6_LYCES (O22299) Homeobox protein knotted-1-like LET6| Length = 355 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = -1 Query: 338 NRVQRHTKPLT--AFKVWPQANKHYYRDDYLA-VCGLTLTPSL 219 N+ +RH KP F V A+ HYY D+ LA + +TPSL Sbjct: 312 NQRKRHWKPSEDMQFVVMDAAHPHYYMDNVLANHFPMDMTPSL 354
>SELA_PSEPK (Q88QJ8) L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)| (Cysteinyl-tRNA(Sec) selenium transferase) (Selenocysteine synthase) (Selenocysteinyl-tRNA(Sec) synthase) Length = 475 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +1 Query: 19 QLPSDKTLLTDPVFRPLVEKYAADE-----KAFFEDYKEAHLRLSELGYAE 156 +LPS TLL P PL++++ D + +D +E R ELG AE Sbjct: 11 RLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLLDDLREP-ARNGELGSAE 60
>PER11_ARATH (Q96519) Peroxidase 11 precursor (EC 1.11.1.7) (Atperox P11)| (ATP23a/ATP23b) Length = 336 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 61 RPLVEKYAADEKAFFEDYKEAHLRLSELGYAEA 159 R +V KYA D AFFE + ++ +++ + +E+ Sbjct: 289 RRIVSKYAEDPVAFFEQFSKSMVKMGNILNSES 321 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,888,173 Number of Sequences: 219361 Number of extensions: 812415 Number of successful extensions: 2340 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 2253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2340 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
