| Clone Name | bags37k11 |
|---|---|
| Clone Library Name | barley_pub |
>APX1_ORYSA (P93404) L-ascorbate peroxidase 1, cytosolic (EC 1.11.1.11) (APXa)| Length = 249 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELGYAEA 70 EKAFFEDYKEAHL+LSELG+A+A Sbjct: 227 EKAFFEDYKEAHLKLSELGFADA 249
>APX1_PEA (P48534) L-ascorbate peroxidase, cytosolic (EC 1.11.1.11) (AP)| Length = 249 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELGYAEA 70 E FF DY EAHL+LSELG+AEA Sbjct: 227 EDVFFADYAEAHLKLSELGFAEA 249
>APX2_ORYSA (Q9FE01) L-ascorbate peroxidase 2, cytosolic (EC 1.11.1.11) (APXb)| Length = 251 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELGYAE 67 E AFF DY EAHL+LSELG+AE Sbjct: 229 EDAFFADYAEAHLKLSELGFAE 250
>APX1_ARATH (Q05431) L-ascorbate peroxidase, cytosolic (EC 1.11.1.11) (AP)| Length = 249 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELGYAEA 70 E AFF DY EAH++LSELG+A+A Sbjct: 227 EDAFFADYAEAHMKLSELGFADA 249
>APX3_ORYSA (Q6TY83) Putative L-ascorbate peroxidase 3 (EC 1.11.1.11)| Length = 291 Score = 32.3 bits (72), Expect = 0.31 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELGY 61 E AFF DY E+H +LSELG+ Sbjct: 226 EDAFFRDYAESHKKLSELGF 245
>APX8_ORYSA (Q69SV0) Probable L-ascorbate peroxidase 8, chloroplast precursor| (EC 1.11.1.11) Length = 478 Score = 31.6 bits (70), Expect = 0.53 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELG 58 ++AFF+DY EAH +LS+LG Sbjct: 327 QEAFFKDYAEAHAKLSDLG 345
>APX6_ORYSA (P0C0L1) Probable L-ascorbate peroxidase 6, chloroplast precursor| (EC 1.11.1.11) Length = 309 Score = 31.6 bits (70), Expect = 0.53 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELG 58 + AFFEDY EAH +LS LG Sbjct: 279 QDAFFEDYAEAHAKLSNLG 297
>APX5_ORYSA (P0C0L0) Probable L-ascorbate peroxidase 5, chloroplast precursor| (EC 1.11.1.11) Length = 320 Score = 31.6 bits (70), Expect = 0.53 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELG 58 + AFFEDY EAH +LS LG Sbjct: 290 QDAFFEDYAEAHAKLSNLG 308
>APX4_ORYSA (Q6ZJJ1) Putative L-ascorbate peroxidase 4 (EC 1.11.1.11)| Length = 291 Score = 31.2 bits (69), Expect = 0.70 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELGY 61 E FF+DY E+H +LSELG+ Sbjct: 225 EDTFFKDYAESHKKLSELGF 244
>RNS10_SHEEP (Q70IB1) Ribonuclease-like protein 10 precursor (Protein Train A)| (Fragment) Length = 161 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 210 KVWPQANKHYYRDDYL-AVCGLTLTPSLDAEQDHP 109 +V Q+NKHY R D + C + P+L + +DHP Sbjct: 96 EVLSQSNKHYLRSDVMDRECNALMAPNLKS-KDHP 129
>APX7_ORYSA (Q7XJ02) Probable L-ascorbate peroxidase 7, chloroplast precursor| (EC 1.11.1.11) Length = 359 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 2 EKAFFEDYKEAHLRLSELG 58 ++AFF+DY AH +LS LG Sbjct: 328 QEAFFKDYAGAHAKLSNLG 346
>CHL12_EMENI (P0C1D3) Protein CHL12| Length = 993 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 281 ISYDRFMASRQTEYNGTPNHXQRSRYGLKPTNIITE 174 +SY+R +ASR T P Q+S YG+ +++ E Sbjct: 186 VSYERLIASRSTT---APGRAQKSYYGIDIHSLLNE 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,087,836 Number of Sequences: 219361 Number of extensions: 530424 Number of successful extensions: 1136 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1136 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)