| Clone Name | bags37i05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FG17B_BRARE (Q6SJP8) Fibroblast growth factor 17b precursor (FGF... | 30 | 3.9 | 2 | RRF_GEOKA (Q5L0J9) Ribosome recycling factor (Ribosome-releasing... | 30 | 5.0 | 3 | Y123_PYRFU (Q8U4G5) UPF0146 protein PF0123 | 30 | 6.6 |
|---|
>FG17B_BRARE (Q6SJP8) Fibroblast growth factor 17b precursor (FGF-17b)| Length = 215 Score = 30.4 bits (67), Expect = 3.9 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 5/80 (6%) Frame = +3 Query: 306 SDTLISRMREKSVENNGKYVAVHLRFE---EDMVAFSCCVFXXXXXXXXXXXX--ARERG 470 +DT SR+R K E+ G+Y+ ++ R + + C+F AR G Sbjct: 90 TDTFGSRVRIKGAES-GRYLCMNRRGKLVGKPNGRGRDCIFTEIVLENNYTALENARHEG 148 Query: 471 WRGKFTRPGRVIRPGAIRMN 530 W FTR GR IR R N Sbjct: 149 WFVAFTRKGRPIRASKTRQN 168
>RRF_GEOKA (Q5L0J9) Ribosome recycling factor (Ribosome-releasing factor)| (RRF) Length = 185 Score = 30.0 bits (66), Expect = 5.0 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +3 Query: 156 VVLPKLIEERVIRISPFANRLSVDAPPAVQRLRCLANFEALKFSKPITALSDTLIS 323 +V+P L EER ++ + S DA AV+ +R AN E K K D L S Sbjct: 100 LVIPPLTEERRRELAKLVKKYSEDAKVAVRNIRRDANDELKKLEKNGEITEDELRS 155
>Y123_PYRFU (Q8U4G5) UPF0146 protein PF0123| Length = 132 Score = 29.6 bits (65), Expect = 6.6 Identities = 19/76 (25%), Positives = 42/76 (55%) Frame = +3 Query: 24 QRLKNDVRVVDKVPGFIMERFSNNLSNVYNFKIKAWSPIQYYKDVVLPKLIEERVIRISP 203 + +KN ++ +++PGF+ + F+ NL +Y K +A I+ ++++ L + +++ Sbjct: 48 EAVKNAIK--ERIPGFVDDVFNPNL-KIY-LKARAIYSIRPNPEIMMALLTLAKKVKVPL 103 Query: 204 FANRLSVDAPPAVQRL 251 + LS D PP +L Sbjct: 104 YIVPLSGDVPPREMKL 119 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,479,648 Number of Sequences: 219361 Number of extensions: 1317713 Number of successful extensions: 3491 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3491 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)