| Clone Name | bags37g21 |
|---|---|
| Clone Library Name | barley_pub |
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 90.5 bits (223), Expect = 1e-18 Identities = 41/74 (55%), Positives = 50/74 (67%) Frame = +1 Query: 1 EYIGAQFTGVRFTDVPVNTGVSFHFILAFAIDYLASQQSKPTPTNGVFRPXWDTGNLTPX 180 EYIG+QF V+F+DVP+N V FHFILAFAIDY + S PTPTNG F+P WDT NL+P Sbjct: 31 EYIGSQFNDVKFSDVPINPDVDFHFILAFAIDYTSG--SSPTPTNGNFKPFWDTNNLSPS 88 Query: 181 XXXXXXXXHPNLSI 222 H N+ + Sbjct: 89 QVAAVKRTHSNVKV 102
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 88.6 bits (218), Expect = 4e-18 Identities = 41/74 (55%), Positives = 49/74 (66%) Frame = +1 Query: 1 EYIGAQFTGVRFTDVPVNTGVSFHFILAFAIDYLASQQSKPTPTNGVFRPXWDTGNLTPX 180 EYIGAQF V+F+DVP+N V FHFILAFAIDY + S PTPTNG F P WDT NL+P Sbjct: 5 EYIGAQFNDVKFSDVPINPNVDFHFILAFAIDYTSG--SSPTPTNGNFNPFWDTNNLSPS 62 Query: 181 XXXXXXXXHPNLSI 222 + N+ + Sbjct: 63 QVAAIKRTYNNVKV 76
>CYB_SCHJP (Q8HMZ7) Cytochrome b| Length = 389 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = +1 Query: 25 GVRFTDVPVNTGVSFHFILAFAIDYLASQQSKPTPTNGVFRPXWDTGNL 171 G + +N S H++L F I LA TNG P TGNL Sbjct: 168 GFNVNNATLNRFFSLHYLLPFIISALAIMHMIALHTNGSSNPLGITGNL 216
>IRX1_HUMAN (P78414) Iroquois-class homeodomain protein IRX-1 (Iroquois| homeobox protein 1) (Homeodomain protein IRXA1) Length = 480 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 111 AVQAHADQRRLQAXLGHGQPHPCRHGRHQSGPP*PE 218 A A +++ LG G PH HG H PP P+ Sbjct: 378 AFLAQGSLLNMRSFLGVGAPHAAPHGPHLPAPPPPQ 413
>RUAP_SOYBN (P39657) RuBisCO-associated protein| Length = 283 Score = 28.5 bits (62), Expect = 4.9 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +1 Query: 43 VPVNTGVSFHFILAFAIDYLASQQSKPTPTNGVFRPXWDTGNLTP 177 +P N F L+ A DY + TNG F P WDT +TP Sbjct: 22 IPENI-TEFQVTLSLARDYDGNNS-----TNGKFIPYWDTEKVTP 60
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 147 AXLGHGQPHPCRHGRHQSGPP*PEHH 224 A L HP H H + PP P HH Sbjct: 999 AALPPAHHHPPHHHHHHAPPPQPHHH 1024
>IRX1_MOUSE (P81068) Iroquois-class homeodomain protein IRX-1 (Iroquois| homeobox protein 1) (Homeodomain protein IRXA1) Length = 480 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 111 AVQAHADQRRLQAXLGHGQPHPCRHGRHQSGPP*PE 218 A A +++ LG PH HG H + PP P+ Sbjct: 378 AFLAQGSLLNMRSFLGVSAPHAAPHGPHLTAPPPPQ 413 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,679,190 Number of Sequences: 219361 Number of extensions: 319772 Number of successful extensions: 1103 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)