| Clone Name | bags37g09 |
|---|---|
| Clone Library Name | barley_pub |
>TFP11_MOUSE (Q9ERA6) Tuftelin-interacting protein 11 (Tuftelin-interacting| protein 39) Length = 838 Score = 31.6 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 16 GSAKSSLPPNVKDLLDSSEEKANLVLRPI 102 G A SS+P N KDL+++ E+ N+V P+ Sbjct: 764 GVAASSVPMNFKDLIETKAEEHNIVFMPV 792
>TFP11_HUMAN (Q9UBB9) Tuftelin-interacting protein 11| Length = 837 Score = 31.6 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 16 GSAKSSLPPNVKDLLDSSEEKANLVLRPI 102 G A SS+P N KDL+++ E+ N+V P+ Sbjct: 763 GVAASSVPMNFKDLIETKAEEHNIVFMPV 791
>Y1292_METJA (Q58688) Hypothetical protein MJ1292| Length = 552 Score = 30.0 bits (66), Expect = 1.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 28 SSLPPNVKDLLDSSEEKANLVLRPIGSALQQVYIIIEGIEKNVGLNPSDPI 180 S L N KDL + K ++ I ++ YII + I N+ L P+ P+ Sbjct: 450 SGLKINAKDLSHDGKIKLKFIVTAITPPYEKYYIIKKNISINLSLIPTPPV 500
>THS_METKA (P50016) Thermosome subunit (Chaperonin-like complex) (CLIC)| Length = 545 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +1 Query: 16 GSAKSSLPPNVKDLLDSSEEKANLVLRPIGSALQQVYIIIEGIEKNVGLNPSDPIVQL 189 G+ + + ++D D E + L + AL+ II + +N GL+P D +VQL Sbjct: 414 GAPEVEVARQLRDFADGVEGREQLAVEAFADALE---IIPRTLAENSGLDPIDVLVQL 468
>HV02_HETFR (P04215) Ig heavy chain V region HC-3 (Fragment)| Length = 89 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 1 LVYYYGSAKSSLPPNVKDLLDSSEEKAN 84 LV YYG +K++ P +KD +S++ +N Sbjct: 20 LVSYYGPSKNAYAPEIKDRFTASKDTSN 47
>RECO_STAES (Q8CP22) DNA repair protein recO (Recombination protein O)| Length = 253 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 280 SIQVTSLQNSRHTRRXSKISLLXLNLQAKLPIEQLGHLGSNQ 155 +I ++L +H S +L LN+ +LPI ++ HL Q Sbjct: 173 AISESALYQDQHAFHLSNRTLYLLNILQQLPISKMNHLNIQQ 214
>RECO_STAEQ (Q5HNY1) DNA repair protein recO (Recombination protein O)| Length = 253 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 280 SIQVTSLQNSRHTRRXSKISLLXLNLQAKLPIEQLGHLGSNQ 155 +I ++L +H S +L LN+ +LPI ++ HL Q Sbjct: 173 AISESALYQDQHAFHLSNRTLYLLNILQQLPISKMNHLNIQQ 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.137 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,484,917 Number of Sequences: 219361 Number of extensions: 730980 Number of successful extensions: 1200 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)