| Clone Name | bags37f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TF3B_MOUSE (Q8CFK2) Transcription factor IIIB 90 kDa subunit (TF... | 31 | 0.95 | 2 | STAR_BOVIN (Q28918) Steroidogenic acute regulatory protein, mito... | 30 | 1.6 | 3 | STAR_SHEEP (P79245) Steroidogenic acute regulatory protein, mito... | 30 | 2.1 | 4 | ZAN_RABIT (P57999) Zonadhesin (Fragment) | 29 | 3.6 | 5 | CSN2_CAEEL (O01422) COP9 signalosome complex subunit 2 (Signalos... | 28 | 8.1 |
|---|
>TF3B_MOUSE (Q8CFK2) Transcription factor IIIB 90 kDa subunit (TFIIIB90)| (hTFIIIB90) (B-related factor 1) (BRF-1) Length = 676 Score = 30.8 bits (68), Expect = 0.95 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = -1 Query: 187 GNSSKRRIHPEVPLDRAKKLK*RSLPLSNAIRQGIASTKLTSSPGLGTEPSKPAAV 20 G S+ +R+ P + AKK + L SSP LG EP KP+AV Sbjct: 584 GTSTGKRLRPLLSAQPAKKA-------------AVGEALLLSSPALGAEPVKPSAV 626
>STAR_BOVIN (Q28918) Steroidogenic acute regulatory protein, mitochondrial| precursor (StAR) (StARD1) Length = 285 Score = 30.0 bits (66), Expect = 1.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 8/37 (21%) Frame = +3 Query: 156 SGWILLLEELPQQRGIVR--------VTXPLAGSDPR 242 +G L EE+PQQ+G++R V PLAGS R Sbjct: 200 AGMATLYEEMPQQKGVIRAEHGPTCMVLRPLAGSPSR 236
>STAR_SHEEP (P79245) Steroidogenic acute regulatory protein, mitochondrial| precursor (StAR) (StARD1) Length = 285 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 8/37 (21%) Frame = +3 Query: 156 SGWILLLEELPQQRGIVR--------VTXPLAGSDPR 242 +G L EE+PQQ+G++R V PLAGS R Sbjct: 200 AGTATLYEEMPQQKGVIRAEHGPTCMVLRPLAGSPSR 236
>ZAN_RABIT (P57999) Zonadhesin (Fragment)| Length = 2282 Score = 28.9 bits (63), Expect = 3.6 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 6/75 (8%) Frame = +3 Query: 3 PVNXRATAAGLDGSVPKPGLEVNLVDAIPC-----RIAFERGKERHFSFLALSNGTSGWI 167 P + T G+ G VP+P + V+ + PC + FE +L S W Sbjct: 116 PGQIQFTVVGVFGDVPEPAVAVDAISIAPCGESFPQCVFEDAAHPFCDWLQASEDGGRWA 175 Query: 168 LLLEE-LPQQRGIVR 209 ++ L Q+R ++R Sbjct: 176 WTDKDMLAQERSLMR 190
>CSN2_CAEEL (O01422) COP9 signalosome complex subunit 2 (Signalosome subunit 2)| Length = 495 Score = 27.7 bits (60), Expect = 8.1 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = -1 Query: 157 EVPLDRAKKLK*RSLPLSNAIRQGIASTKLTSSPGLGTEPSKPAAV 20 E+P ++ KK+ SL + NA QG +TK S PG +EPS +V Sbjct: 410 EMPKNK-KKMMVTSLVVPNAGDQG--TTKSDSKPGTSSEPSTTTSV 452 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,904,409 Number of Sequences: 219361 Number of extensions: 589521 Number of successful extensions: 1321 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)