| Clone Name | bags36p07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CBX6_HUMAN (O95503) Chromobox protein homolog 6 | 31 | 2.8 |
|---|
>CBX6_HUMAN (O95503) Chromobox protein homolog 6| Length = 412 Score = 31.2 bits (69), Expect = 2.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 297 TRATRSPSEERPDFLVTTHS*ALPSWNKPEIMALNLVTDMVFSNRR 160 T + P + P L T S + PSW +PE++ L+L + +++R Sbjct: 282 TPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKR 327 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,786,670 Number of Sequences: 219361 Number of extensions: 1424455 Number of successful extensions: 3968 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3968 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)