| Clone Name | bags37d24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MIG15_CAEEL (Q23356) Serine/threonine-protein kinase mig-15 (EC ... | 30 | 7.0 |
|---|
>MIG15_CAEEL (Q23356) Serine/threonine-protein kinase mig-15 (EC 2.7.11.1)| (Abnormal cell migration protein 15) Length = 1096 Score = 29.6 bits (65), Expect = 7.0 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 14/58 (24%) Frame = +1 Query: 22 RSRQQAATPPLHLPPPRGTSFSS-------------ANANCSSLVPI-AHGDGTCQSP 153 RSR+++ +PP PPPR S SS A+A L I +G+GT + P Sbjct: 525 RSREESMSPPPPAPPPREASISSITDTIDVGELDNGADAEWDDLKDIMMNGEGTLRGP 582 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,527,729 Number of Sequences: 219361 Number of extensions: 1266642 Number of successful extensions: 3525 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3524 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)