| Clone Name | bags36n16 |
|---|---|
| Clone Library Name | barley_pub |
>UREH_HAEIN (P44397) Urease accessory protein ureH| Length = 261 Score = 31.2 bits (69), Expect = 2.5 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -2 Query: 136 RYDFGKLSGLITKAYIIWADATEKSNASPCLQWLPQKWNL 17 R+ F + S + K Y + D ++ S C+QWLP K NL Sbjct: 151 RFAFRQFSSHL-KIYALQNDGKKRPLVSDCIQWLPSKMNL 189
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 30.0 bits (66), Expect = 5.7 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 424 RRTTKGTNVNEKYRGNVFLNVDEVTVTL 341 RR TK NVN KY V NVDEV VT+ Sbjct: 79 RRITKAKNVNMKYSAAV--NVDEVPVTV 104
>STP2_YEAST (P38704) Zinc finger protein STP2| Length = 541 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 189 RDSCRGGHVDLIGLSAYFANKKNSNLINLTKSPSVIPCSV 308 +D C DL+ +S F K+N+ ++LT SV+PC++ Sbjct: 57 KDCCATEKDDLVDVSELFP-KQNNKQLSLTSKSSVVPCAL 95
>NIFW_ACEDI (Q9FA11) Nitrogenase-stabilizing/protective protein nifW| Length = 107 Score = 29.6 bits (65), Expect = 7.4 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 120 LPKSYRDFIQKTGPVAEPVYKAVRDSCR--GGHVDLIGLS 233 L ++Y DF + T P+AE V+K RD+ R GG V L L+ Sbjct: 65 LQRAYDDFTRST-PIAERVFKVHRDAVRPSGGFVSLSELT 103
>CP302_DROME (Q9NGX9) Cytochrome P450 302a1, mitochondrial precursor (EC| 1.14.99.-) (Disembodied protein) Length = 489 Score = 29.6 bits (65), Expect = 7.4 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +3 Query: 96 AFVMRPESLPKSYRDFIQKTGPVAEPVYKAVRDSCRGGHVDLI 224 A V + S PKS R+F+++ V + + +++S GG +D++ Sbjct: 132 AQVQKELSAPKSVRNFVRQVDGVTKEFIRFLQESRNGGAIDML 174
>IBRD2_HUMAN (Q7Z419) E3 ubiquitin ligase IBRDC2 (EC 6.3.2.-) (IBR| domain-containing protein 2) (p53-inducible RING finger protein) Length = 303 Score = 29.6 bits (65), Expect = 7.4 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 401 ICPLCCSTSSK--VFGIPSCNLLACSCGCSSLYHFFVSVCHSLPV 529 +CP+ S + + PSC+L CSC C +H VS S P+ Sbjct: 129 VCPVASSDPGQPVLVECPSCHLKFCSC-CKDAWHAEVSCRDSQPI 172
>AKA10_HUMAN (O43572) A kinase anchor protein 10, mitochondrial precursor| (Protein kinase A-anchoring protein 10) (PRKA10) (Dual specificity A kinase-anchoring protein 2) (D-AKAP-2) Length = 662 Score = 29.3 bits (64), Expect = 9.7 Identities = 31/125 (24%), Positives = 47/125 (37%), Gaps = 12/125 (9%) Frame = +3 Query: 126 KSYRDFIQKTGPVAEPVYKAVRDSCRGGHVDLIGLSAYFANKKNSNLINLTKSPSVIPCS 305 KS + I P A+ ++ HV + +SA + +S L K PS + + Sbjct: 42 KSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAA 101 Query: 306 VIHADRASCLAHNVTVTSSTFKKTFPLYFSLT-----FVPFVVLRLQKFL-------ESP 449 SCL + T S+ KT T F+ F+ LR + L ES Sbjct: 102 HFGDLGRSCLDYQTQETKSSLSKTLEQVLHDTIVLPYFIQFMELRRMEHLVKFWLEAESF 161 Query: 450 AATCW 464 +T W Sbjct: 162 HSTTW 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,964,310 Number of Sequences: 219361 Number of extensions: 1788625 Number of successful extensions: 4978 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4977 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)