| Clone Name | bags37c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COLI1_ONCMY (Q04617) Corticotropin-lipotropin A precursor (Pro-o... | 30 | 6.0 | 2 | VGLG_VHSV0 (P27662) Spike glycoprotein precursor | 30 | 7.9 |
|---|
>COLI1_ONCMY (Q04617) Corticotropin-lipotropin A precursor (Pro-opiomelanocortin| A) (POMC A) [Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediary peptide 1 (CLIP-1); Lipo Length = 253 Score = 30.0 bits (66), Expect = 6.0 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 437 ERIPSKILVYQASDDPLYSGYRAAVEASAQEETLLG-FAIWEPPHGPYRTRNYPWKG 604 E PS++ +DD +Y A + E + G F++ E G Y+ ++ W G Sbjct: 136 EAFPSEMRRELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSG 192
>VGLG_VHSV0 (P27662) Spike glycoprotein precursor| Length = 507 Score = 29.6 bits (65), Expect = 7.9 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -1 Query: 635 NASMLHQLWXNPSKDSSSFCMDHGVVPI*QNLTGFPLVLMPRQLPCTHYIEDHQK 471 N S H W P S C D VPI P QL C H ED K Sbjct: 30 NISTYHADWDTPLYTHPSNCRDDSFVPI-----------RPAQLRCPHEFEDINK 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,237,469 Number of Sequences: 219361 Number of extensions: 1861349 Number of successful extensions: 3698 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3697 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)