| Clone Name | bags37b24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BCHG_CHLAU (P33326) Bacteriochlorophyll synthase 34 kDa chain | 31 | 2.7 | 2 | HAIR_HUMAN (O43593) Protein hairless | 30 | 7.9 |
|---|
>BCHG_CHLAU (P33326) Bacteriochlorophyll synthase 34 kDa chain| Length = 310 Score = 31.2 bits (69), Expect = 2.7 Identities = 22/82 (26%), Positives = 39/82 (47%) Frame = +2 Query: 2 VAFGMDTAKWICVGAIDITQLSVAAYLLSTGKLYYALALVGLTIPQVILQFQYFLKDPVK 181 V +G A + V + + Q++V L G A + L Q I + F++DP Sbjct: 226 VQYGKVMAARMVVTTMGVAQIAVIGLLFHWGHPVAATVVAILLAAQSIPNAR-FIRDPEN 284 Query: 182 YDVKYQASAQPFFVFGLLVTAL 247 +V + A+A +V+G+L A+ Sbjct: 285 NEVFFNATAIMLYVWGMLAAAI 306
>HAIR_HUMAN (O43593) Protein hairless| Length = 1189 Score = 29.6 bits (65), Expect = 7.9 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +1 Query: 52 HHSIICCSLPPEHWQAVLCLGTSWT----DNSPGDLAVSVLPEGPCEVRRQI 195 HH +C P W+ VL SW P D+ V EGP R++ Sbjct: 37 HHGPLCLGEPAPFWRGVLSTPDSWLPPGFPQGPKDMLPLVEGEGPQNGERKV 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,003,549 Number of Sequences: 219361 Number of extensions: 1881279 Number of successful extensions: 4586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4580 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)