ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags37b03 |
|---|---|
| Clone Library Name | barley_pub |
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 33.5 bits (75), Expect = 0.37 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = -2 Query: 378 PRQWTHAKPPRR----SCTGASPRRANHPSPPRLPPWHQRRS 265 P + T + PPR+ S + + PRR + PSPP PP RRS Sbjct: 370 PPKRTVSSPPRKTRRLSPSASPPRRRHRPSPPASPPPKPRRS 411
>MMP16_MOUSE (Q9WTR0) Matrix metalloproteinase-16 precursor (EC 3.4.24.-)| (MMP-16) (Membrane-type matrix metalloproteinase 3) (MT-MMP 3) (MTMMP3) (Membrane-type-3 matrix metalloproteinase) (MT3-MMP) (MT3MMP) Length = 607 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 354 PPRRSCTGASPRRANHPSPPRLP 286 PP RS A PRR + P PPR P Sbjct: 307 PPHRSVPPADPRRHDRPKPPRPP 329
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 30.8 bits (68), Expect = 2.4 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -2 Query: 405 APAPE*RVTPRQWTHAKPPRRSCTGASPRRANHPSPPRLPPWHQRR 268 AP P R TP PPRR PRR + PSP R P QRR Sbjct: 564 APPPRRRRTP-----TPPPRRRTPSPPPRRRS-PSPRRYSPPIQRR 603 Score = 30.0 bits (66), Expect = 4.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -2 Query: 360 AKPPRR----SCTGASPRRANHPSPPRLPPWHQRRS 265 + PPR+ S + + PRR + PSPP PP R S Sbjct: 379 SSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHS 414
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 30.8 bits (68), Expect = 2.4 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -2 Query: 405 APAPE*RVTPRQWTHAKPPRRSCTGASPRRANHPSPPRLPPWHQRR 268 AP P R TP PPRR PRR + PSP R P QRR Sbjct: 578 APPPRRRRTP-----TPPPRRRTPSPPPRRRS-PSPRRYSPPIQRR 617 Score = 30.0 bits (66), Expect = 4.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -2 Query: 360 AKPPRR----SCTGASPRRANHPSPPRLPPWHQRRS 265 + PPR+ S + + PRR + PSPP PP R S Sbjct: 379 SSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHS 414
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 30.4 bits (67), Expect = 3.1 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -2 Query: 402 PAPE*RVTPRQWTHAKPPRRSCTGASPRRANHPSPPRLPPWHQRR 268 P P PR+ PP R T + P R PSP R P QRR Sbjct: 578 PPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRR 622
>MMP16_RAT (O35548) Matrix metalloproteinase-16 precursor (EC 3.4.24.-)| (MMP-16) (Membrane-type matrix metalloproteinase 3) (MT-MMP 3) (MTMMP3) (Membrane-type-3 matrix metalloproteinase) (MT3-MMP) (MT3MMP) Length = 607 Score = 30.0 bits (66), Expect = 4.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 354 PPRRSCTGASPRRANHPSPPRLP 286 PP RS A PR+ + P PPR P Sbjct: 307 PPHRSVPPADPRKNDRPKPPRPP 329
>MMP16_HUMAN (P51512) Matrix metalloproteinase-16 precursor (EC 3.4.24.-)| (MMP-16) (Membrane-type matrix metalloproteinase 3) (MT-MMP 3) (MTMMP3) (Membrane-type-3 matrix metalloproteinase) (MT3-MMP) (MT3MMP) (MMP-X2) Length = 607 Score = 30.0 bits (66), Expect = 4.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 354 PPRRSCTGASPRRANHPSPPRLP 286 PP RS A PR+ + P PPR P Sbjct: 307 PPHRSIPPADPRKNDRPKPPRPP 329
>PMYT1_HUMAN (Q99640) Membrane-associated tyrosine- and threonine-specific| cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase) Length = 499 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 378 PRQWTHAKPPRRSCTGASPRRANHPSPPRLPPWHQRRSRR 259 PR + + PP G+ P + PPR P WHQ + RR Sbjct: 44 PRGLSRSLPPPPPAKGSIP--ISRLFPPRTPGWHQLQPRR 81
>PMYT1_MOUSE (Q9ESG9) Membrane-associated tyrosine- and threonine-specific| cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase) Length = 490 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 378 PRQWTHAKPPRRSCTGASPRRANHPSPPRLPPWHQRRSRR 259 P + + PPR G P + PPR P WHQ + RR Sbjct: 35 PGGLSRSLPPRPPAKGCIP--VSRLFPPRTPGWHQPQPRR 72
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 29.3 bits (64), Expect = 7.0 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 Query: 402 PAPE*RVTPRQWTHAKPPRRSCTGASPRRANHPSPPRLPP 283 PAP P Q +P G SP+ PSPP+ PP Sbjct: 38 PAPTPSPCPPQPPKPQPKPPPAPGPSPKPGPSPSPPKPPP 77
>ATS5_MOUSE (Q9R001) ADAMTS-5 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 5) (ADAM-TS 5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (Implantin) Length = 930 Score = 28.9 bits (63), Expect = 9.1 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 360 AKPPRRSC-TGASPRRANHPSPPRLPPWHQRRSRRSGVAVEL 238 A PPR SC T ASP P P H R RRS +A +L Sbjct: 202 ALPPRASCETPASPS-----GPQESPSVHSRSRRRSALAPQL 238
>NMDE4_HUMAN (O15399) Glutamate [NMDA] receptor subunit epsilon 4 precursor| (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D) (EB11) Length = 1336 Score = 28.9 bits (63), Expect = 9.1 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -2 Query: 378 PRQWTHAKPPRRSCTGASPR------RANHPSPPRLPPWHQRRSRRSG 253 P W PRR PR RA+H +P P H R R +G Sbjct: 1211 PPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAG 1258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,210,243 Number of Sequences: 219361 Number of extensions: 663269 Number of successful extensions: 2494 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2477 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
