| Clone Name | bags37a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYD_MYCLE (P36429) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspar... | 31 | 0.84 | 2 | CCNB3_HUMAN (Q8WWL7) G2/mitotic-specific cyclin-B3 | 31 | 1.1 | 3 | LOX12_PIG (P16469) Arachidonate 12-lipoxygenase, 12S-type (EC 1.... | 29 | 4.2 | 4 | LOX12_BOVIN (P27479) Arachidonate 12-lipoxygenase, 12S-type (EC ... | 28 | 5.4 | 5 | OR19B_DROME (Q8IRZ5) Putative odorant receptor 19b | 28 | 7.1 | 6 | OR19A_DROME (Q9I816) Putative odorant receptor 19a | 28 | 7.1 |
|---|
>SYD_MYCLE (P36429) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) (Antigen T5) Length = 589 Score = 31.2 bits (69), Expect = 0.84 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 13 PKPEIEESIPTQDASELKIANDASVHGHECHEGETSV 123 PKPE E+SI + S L A D +GHE G + Sbjct: 454 PKPEFEDSIESDPGSVLADAYDIVCNGHEIGSGSVRI 490
>CCNB3_HUMAN (Q8WWL7) G2/mitotic-specific cyclin-B3| Length = 1395 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 10 KPKPEIEESIPTQDASELKIANDASVHGHECH 105 K KP+ EESIPT S LK +++G CH Sbjct: 269 KKKPKTEESIPTHKLSSLK--KKCTIYGKICH 298
>LOX12_PIG (P16469) Arachidonate 12-lipoxygenase, 12S-type (EC 1.13.11.31)| (12-LOX) Length = 662 Score = 28.9 bits (63), Expect = 4.2 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -1 Query: 115 FRLHGIHAHVLRHHLLSSV 59 F+LH +H+H+LR HL++ V Sbjct: 352 FQLHELHSHLLRGHLMAEV 370
>LOX12_BOVIN (P27479) Arachidonate 12-lipoxygenase, 12S-type (EC 1.13.11.31)| (12-LOX) Length = 662 Score = 28.5 bits (62), Expect = 5.4 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -1 Query: 115 FRLHGIHAHVLRHHLLSSV 59 F+LH +H+H+LR HL++ V Sbjct: 352 FQLHELHSHLLRGHLVAEV 370
>OR19B_DROME (Q8IRZ5) Putative odorant receptor 19b| Length = 387 Score = 28.1 bits (61), Expect = 7.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 100 IHAHVLRHHLLSSVQKHLE*VCFLQFQA*AC 8 IH H + L S+++ L CFLQF + AC Sbjct: 238 IHDHQIILRLFKSLERSLSMTCFLQFFSTAC 268
>OR19A_DROME (Q9I816) Putative odorant receptor 19a| Length = 387 Score = 28.1 bits (61), Expect = 7.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 100 IHAHVLRHHLLSSVQKHLE*VCFLQFQA*AC 8 IH H + L S+++ L CFLQF + AC Sbjct: 238 IHDHQIILRLFKSLERSLSMTCFLQFFSTAC 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.303 0.124 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,847,392 Number of Sequences: 219361 Number of extensions: 122904 Number of successful extensions: 250 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.8 bits)