| Clone Name | bags36j18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TEGU_SHV21 (Q01056) Probable large tegument protein | 30 | 6.5 | 2 | DPO4_YEAST (P25615) DNA polymerase IV (EC 2.7.7.7) (POL IV) | 30 | 8.4 |
|---|
>TEGU_SHV21 (Q01056) Probable large tegument protein| Length = 2469 Score = 30.0 bits (66), Expect = 6.5 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = -3 Query: 350 STKHGAQKYHNMSVEKSNHEIIIFLPSSV--GELPCNSALRMHGGEE*IHKNSYIDKIRN 177 ST +KY + + ++FL SS E P S +HG E + + ID I Sbjct: 17 STHQADEKYGQYAGSQCLSNCVMFLVSSYYNDETPVTS---LHGLNEILKYGAKIDFILR 73 Query: 176 LSDKTGRRKISQNHHITFFL 117 S + G + +Q HHI ++ Sbjct: 74 RSGQLGHNQYAQLHHIPGYI 93
>DPO4_YEAST (P25615) DNA polymerase IV (EC 2.7.7.7) (POL IV)| Length = 581 Score = 29.6 bits (65), Expect = 8.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 65 PPCVLRAELHGSFQRWLARKKLCGDFEIFFSYPFC 169 P C + EL GS+ R ++ CGD ++ F PFC Sbjct: 347 PEC--QVELQGSYNRGYSK---CGDIDLLFFKPFC 376 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,460,867 Number of Sequences: 219361 Number of extensions: 1615562 Number of successful extensions: 3068 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3068 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)