| Clone Name | bags36f21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CIA1_SCHPO (O74515) Histone chaperone cia1 | 44 | 9e-05 | 2 | ASF1_YEAST (P32447) Anti-silencing protein 1 | 40 | 0.002 | 3 | ETV5_HUMAN (P41161) ETS translocation variant 5 (Ets-related pro... | 28 | 5.2 | 4 | K6PF_HAECO (Q27665) 6-phosphofructokinase (EC 2.7.1.11) (Phospho... | 28 | 6.7 |
|---|
>CIA1_SCHPO (O74515) Histone chaperone cia1| Length = 262 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +2 Query: 83 MSAVNITNVAVLDNPTAFLNPFQFEISYECLVP 181 MS VNI +V VL+NP F +P++FEI++ECL P Sbjct: 1 MSIVNILSVNVLNNPAKFSDPYKFEITFECLEP 33
>ASF1_YEAST (P32447) Anti-silencing protein 1| Length = 279 Score = 40.0 bits (92), Expect = 0.002 Identities = 15/31 (48%), Positives = 24/31 (77%) Frame = +2 Query: 83 MSAVNITNVAVLDNPTAFLNPFQFEISYECL 175 MS V++ + VL+NP F +P++FEI++ECL Sbjct: 1 MSIVSLLGIKVLNNPAKFTDPYEFEITFECL 31
>ETV5_HUMAN (P41161) ETS translocation variant 5 (Ets-related protein ERM)| Length = 510 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 109 GGAGQPHRLPQPLPVRDLLRVPRP 180 G A PH LP+P P + VPRP Sbjct: 173 GPAPAPHSLPEPGPQQQTFAVPRP 196
>K6PF_HAECO (Q27665) 6-phosphofructokinase (EC 2.7.1.11) (Phosphofructokinase)| (Phosphohexokinase) Length = 789 Score = 28.1 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 29 SPSCVD*RERPGRRKAA-AMSAVNITNVAVLDNPTAFLNPFQFEISYECLV 178 S C D R+R GR KAA + ITN+ V+ + + QF + LV Sbjct: 102 SARCTDLRQREGRMKAAYNLIEKGITNLVVIGGDGSLIGANQFRKDWPGLV 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,201,623 Number of Sequences: 219361 Number of extensions: 209086 Number of successful extensions: 831 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)