| Clone Name | bags35n16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (E... | 30 | 3.9 | 2 | GLMM_PARUW (Q6MBL8) Phosphoglucosamine mutase (EC 5.4.2.10) | 30 | 5.0 | 3 | FSH_DROME (P13709) Homeotic protein female sterile (Fragile-chor... | 30 | 5.0 | 4 | CAD23_HUMAN (Q9H251) Cadherin-23 precursor (Otocadherin) | 29 | 6.6 |
|---|
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 30.0 bits (66), Expect = 3.9 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +2 Query: 356 NRELEVQVLDFGLLAILCRLSEFGTCSKLMLDKLHWIINHIDGLCADGP 502 N E+ Q++ G + C+ + T + + + ++W+++H+D D P Sbjct: 615 NEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDAP 663
>GLMM_PARUW (Q6MBL8) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 457 Score = 29.6 bits (65), Expect = 5.0 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 32 VIMQSTRLILDTVKGAWAVIKPCSIGEVQSTLRTCKEEVNILDVNS 169 + +++ +++LD GA + P E+ +T+ TC N L++NS Sbjct: 176 ISLKNLKIVLDCANGAGYKVAPLVFKELDATVFTCGVTPNGLNINS 221
>FSH_DROME (P13709) Homeotic protein female sterile (Fragile-chorion membrane| protein) Length = 2038 Score = 29.6 bits (65), Expect = 5.0 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = -1 Query: 335 SSFSQMYPTSLAKYQVMWGQKHENHPTERNAIFQQ*AVLHQDSHTQNSRRHQLTQKNL 162 +SF + P SL + Q+ Q + H ++ Q HQ H Q ++ QLTQ+ L Sbjct: 1488 ASFLDLEP-SLQQQQMQQMQLQQQHHQQQQQQTHQQQQQHQQQHHQQQQQQQLTQQQL 1544
>CAD23_HUMAN (Q9H251) Cadherin-23 precursor (Otocadherin)| Length = 3354 Score = 29.3 bits (64), Expect = 6.6 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 146 VNILDVNSSGSTGAFLSFVCDYLDAVQLIVEIWRFVQLD 262 VN+LD+N + T L FV + L+ + V I++ V +D Sbjct: 878 VNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAID 916 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,704,096 Number of Sequences: 219361 Number of extensions: 1310012 Number of successful extensions: 2984 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2983 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)