| Clone Name | bags35k18 |
|---|---|
| Clone Library Name | barley_pub |
>PIP_AERSO (P46547) Proline iminopeptidase (EC 3.4.11.5) (PIP) (Prolyl| aminopeptidase) (PAP) Length = 424 Score = 88.2 bits (217), Expect = 5e-18 Identities = 42/92 (45%), Positives = 57/92 (61%) Frame = +2 Query: 71 FLKEFDMWVGFDQNPLYALLHESIYCEGSSSKWTADKIFNENRSXXDPVKVXXEGRPVYL 250 FL + F+ NP++A+LHE IYCEG++S W A+++ E P +G+ Sbjct: 265 FLYQVQAMQPFNTNPVFAILHELIYCEGAASHWAAERVRGEF-----PALAWAQGKDFAF 319 Query: 251 TGEMVFPCFFDEINALRPLKEAAHLLAEKEDW 346 TGEM+FP F++ L PLKEAAHLLAEK DW Sbjct: 320 TGEMIFPWMFEQFRELIPLKEAAHLLAEKADW 351
>ATPG_CORJK (Q4JUJ9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 326 Score = 31.2 bits (69), Expect = 0.66 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +2 Query: 26 DPVLVPGAKKSISYYFLKEFDM---WVGFDQNPLYALLHE 136 D VL K ISYY + D+ W G+ Q+P YA H+ Sbjct: 112 DVVLYVSGNKGISYYNFRGEDIAGAWSGYSQDPDYAATHD 151
>CSBB_BACSU (Q45539) Putative glycosyl transferase csbB (EC 2.-.-.-)| Length = 329 Score = 30.8 bits (68), Expect = 0.86 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 71 FLKEFDMWVGFDQNPLYALLHESIYCEGSSSKWTADKIFN 190 F K W+GFDQ ++ +E++ + +SKW+ +FN Sbjct: 178 FSKGLFCWIGFDQKIVF---YENVERKNGTSKWSFSSLFN 214
>ATPG_MYCPA (Q73X58) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 304 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +2 Query: 29 PVLVPGAKKSISYYFLKEFDM---WVGFDQNPLY 121 PVL +K+++YY + +D+ W GF + P Y Sbjct: 114 PVLYSVGRKALNYYTFRNWDISGSWTGFSEQPQY 147
>SLS1_YEAST (P42900) Sigma-like sequence protein 1, mitochondrial precursor| (Protein SLS1) Length = 643 Score = 28.9 bits (63), Expect = 3.3 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -1 Query: 158 KIPHSR*TRAREHKEDFDQNLPTCQTL---SRSNSLYSFLRQERVQDPT 21 K P R ++ R HKE D NL L + NSL S L R++ PT Sbjct: 53 KQPRHRPSKKRSHKETGDNNLDFGSKLLVFEKQNSLDSALNSIRLKKPT 101
>MATK_LEMMN (Q8WHM4) Maturase K (Intron maturase)| Length = 512 Score = 28.9 bits (63), Expect = 3.3 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -1 Query: 203 NFYFH*KSYRLSILMKIPHSR--*TRAREHKEDFDQNLPTCQTLSRSNSLYSFLRQE 39 NFY+ S +I+++IP SR + +E KE +P Q L +SL+SFL + Sbjct: 93 NFYYQMISEAFAIVVEIPFSRRLVSSLKEKKE-----IPKYQNLRSIHSLFSFLEDK 144
>SYM_CLOPE (Q8XHG1) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 645 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 101 FDQNPLYALLHESIYCEGSSSKWTADKIFNEN 196 +DQ +Y +E +YC S WT ++ N N Sbjct: 113 YDQGDIYKDSYEGLYCTPCESFWTETQLVNGN 144
>CCR6_MOUSE (O54689) C-C chemokine receptor type 6 (C-C CKR-6) (CC-CKR-6)| (CCR-6) (KY411) (CD196 antigen) Length = 367 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +2 Query: 26 DPVLVPGAKKSISYYFLKEF-DMWVGFDQNPLYALLHESIYCEGSSSKWTADKIFNENRS 202 +PVL + YF+K D+W +N + L +Y E S+ T++ + N+N S Sbjct: 304 NPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVENDNAS 363
>CTGE2_HUMAN (Q96RT6) Protein cTAGE-2| Length = 754 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 74 LKEFDMWVGFDQNPLYALLHESIYCEGSSSKWTADKIFNENR 199 LKEF+ + F Q + +LHE + S+ WTA++ N+ R Sbjct: 408 LKEFEKTIHFYQKKI--ILHEKKARDNWSAAWTAERNLNDLR 447
>ATPG_CORGL (Q79VG6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 325 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +2 Query: 50 KKSISYYFLKEFDM---WVGFDQNPLYALLH 133 KK + YY + D+ W GF Q+P +A H Sbjct: 120 KKGVDYYKFRAEDVAGTWTGFSQDPDWAATH 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,330,323 Number of Sequences: 219361 Number of extensions: 693322 Number of successful extensions: 1692 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1690 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)