| Clone Name | bags35k04 |
|---|---|
| Clone Library Name | barley_pub |
>YHRE_SCHPO (Q9P7Z3) Hypothetical protein C839.14c in chromosome II| Length = 238 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 172 SMLGLQSYWDASYSEDLTNFXEHGHAVEIW 261 S LG + YWD Y +++NF E E+W Sbjct: 7 SKLGTKQYWDNVYEREVSNFTEFNDEGEVW 36
>EBNA2_EBV (P12978) Epstein-Barr nuclear antigen 2 (EBV nuclear antigen 2)| (EBNA-2) Length = 487 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 53 TSATPTLLMCSPRLRXPGTSPPLPLITVLIKMTK 154 T P L PR P T PP PL+TVL + T+ Sbjct: 204 TPLPPATLTVPPRPTRPTTLPPTPLLTVLQRPTE 237
>EBNA2_EBVG (Q3KSV2) Epstein-Barr nuclear antigen 2 (EBV nuclear antigen 2)| (EBNA-2) (EBNA2) Length = 451 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 53 TSATPTLLMCSPRLRXPGTSPPLPLITVLIKMTK 154 T P L PR P T PP PL+TVL + T+ Sbjct: 170 TPLPPATLTVPPRPTRPTTLPPTPLLTVLQRPTE 203
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 7/44 (15%) Frame = +2 Query: 14 GPCG-ASTGARSMTTSATPTL------LMCSPRLRXPGTSPPLP 124 GP G AS G S + +TP ++ +P L PG +PPLP Sbjct: 168 GPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLP 211
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 7/44 (15%) Frame = +2 Query: 14 GPCG-ASTGARSMTTSATPTL------LMCSPRLRXPGTSPPLP 124 GP G AS G S + +TP ++ +P L PG +PPLP Sbjct: 168 GPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAAPPLP 211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.308 0.128 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,307,797 Number of Sequences: 219361 Number of extensions: 426005 Number of successful extensions: 1056 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)