| Clone Name | bags35j15 |
|---|---|
| Clone Library Name | barley_pub |
>NPP_HORVU (Q687E1) Nucleotide pyrophosphatase/phosphodiesterase (EC 3.-.-.-)| (Fragments) Length = 368 Score = 31.2 bits (69), Expect = 0.74 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -3 Query: 157 SLVFAKPSTFTTTWSPIQNSPQQIELLAGDGGNVEDDCS 41 S+V+AKP TF +P QNS Q+I ++ GD G E D S Sbjct: 22 SVVWAKPYTFRAPPTPGQNSLQRI-IVFGDMGKAERDGS 59
>AB1IP_HUMAN (Q7Z5R6) Amyloid beta A4 precursor protein-binding family B member| 1-interacting protein (APBB1-interacting protein 1) (Rap1-GTP-interacting adapter molecule) (RIAM) (Proline-rich EVH1 ligand 1) (PREL-1) (Proline-rich protein 73) (Retinoic ac Length = 666 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 162 HHPWCSPNRPHSPPHGRPSKTPLNRSNSLLATAAT 58 HH P PH+P P P+ RS+ + AT Sbjct: 500 HHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPAT 534
>PER_DROTP (P91716) Period circadian protein (Fragment)| Length = 390 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 147 SPNRPHSPPHGRPSKTPLNRSNSLLATAATSRMTVLLY 34 SPNRPH H S + S + AT MT ++Y Sbjct: 334 SPNRPHKHAHVHSSSEKPSTSQAAAATMPLQYMTGVMY 371
>AXN2_MOUSE (O88566) Axin-2 (Axis inhibition protein 2) (Conductin) (Axin-like| protein) (Axil) Length = 840 Score = 28.1 bits (61), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 176 LLSNAIILGVRQTVHIHHHMVAHPKLPST 90 LL L + T H+HHH + H +P T Sbjct: 497 LLGGKSFLTKQTTKHVHHHYIHHHAVPKT 525
>PMS2_HUMAN (P54278) PMS1 protein homolog 2 (DNA mismatch repair protein PMS2)| Length = 862 Score = 28.1 bits (61), Expect = 6.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -1 Query: 141 NRPHSPPHGRPSKTPLNRSNSLLATAATSRMT 46 N+PHSP P ++PL + +L+++ + ++ Sbjct: 432 NKPHSPKTPEPRRSPLGQKRGMLSSSTSGAIS 463
>AXN2_RAT (O70240) Axin-2 (Axis inhibition protein 2) (Conductin) (Axin-like| protein) (Axil) Length = 838 Score = 28.1 bits (61), Expect = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 176 LLSNAIILGVRQTVHIHHHMVAHPKLPST 90 LL L + T H+HHH + H +P T Sbjct: 495 LLGGKSFLTKQTTKHVHHHYIHHHAVPKT 523
>NRG2_HUMAN (O14511) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Neural- and thymus-derived activator for ERBB kinases) (NTAK) (Divergent of neuregulin-1) (DON-1)] Length = 850 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 147 SPNRPHSPPHGRPSKTPLNRSNSLLATAATSR 52 S +RP +PP RP + P RS + AA SR Sbjct: 55 SISRPAAPPEPRPQQQPQPRSPAARRAAARSR 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.127 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,969,253 Number of Sequences: 219361 Number of extensions: 524435 Number of successful extensions: 2106 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2103 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)