| Clone Name | bags35h21 |
|---|---|
| Clone Library Name | barley_pub |
>YE99_SCHPO (O13771) Hypothetical protein C17A5.09c in chromosome I| Length = 310 Score = 32.0 bits (71), Expect = 0.88 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +3 Query: 306 NLRKTADINGSLADELGDQAGEIPQVGGAKVSKKRNYSFSYDPSEVFVE 452 NL +T + A LGD G +P +K SK N SFS D + +V+ Sbjct: 99 NLDETDSKDDFTAGTLGDTLGTLPSTRVSKDSKDDNVSFSSDKKQFYVK 147
>Y1816_SHEON (Q8EFZ8) UPF0319 protein SO1816 precursor| Length = 226 Score = 30.8 bits (68), Expect = 2.0 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +3 Query: 18 VLKEPKVDSQNKQLSLIESEKSKMNYTV 101 V+K+PKV +QN Q+ L ++K ++NY V Sbjct: 105 VVKKPKVFAQNPQVVLTRADKGQVNYQV 132
>SA155_YEAST (P43612) SIT4-associating protein SAP155| Length = 1002 Score = 29.6 bits (65), Expect = 4.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 160 FLKGN*KCHLQSQHQYLGFENALR*YSNALLRRVLVMIMVDFF 288 FLK N L Q QYL F R + + +L+ V + +++DFF Sbjct: 330 FLKINQNLLLTRQDQYLNFIRTERSFVDDMLKHVDISLLMDFF 372
>NDC1_XENLA (Q6AX31) Nucleoporin NDC1 (xNDC1) (Transmembrane protein 48)| Length = 660 Score = 29.3 bits (64), Expect = 5.7 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = +3 Query: 270 DNGRLLQNCVPKNLRKTADING-SLADELGDQA---GEIPQVGGAKVSKKRNYSFSYDPS 437 +NGR+ PK +RK++ +G SL ++ +Q IP++G + K + S D Sbjct: 377 NNGRMRVPSSPKQIRKSSSSSGTSLIEDSAEQTQNLSTIPRIGIPSLLKTASLKSSLDIG 436 Query: 438 EVFVEPRRKYQRSTI 482 F P K ++ Sbjct: 437 SPFATPGVKQMSESL 451
>SPD1A_XENLA (Q9PU13) Speedy protein 1-A (Spy1-A) (XSpy1-A) (Rapid inducer of| G2/M progression in oocytes A) (RINGO-A) (p33 ringo-A) (xRINGO-A) (Protein Ls26) Length = 299 Score = 28.5 bits (62), Expect = 9.7 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = -2 Query: 288 EEVYHYHDQNSSQESV*ISPERIFEPK 208 +E++HY ++ SQE + +SPE + +P+ Sbjct: 246 QEIFHYTNREWSQELLMLSPELLLDPE 272
>ZIC3_XENLA (O57311) Zinc finger protein ZIC 3 (Zinc finger protein of the| cerebellum 3) (ZIC3 protein) Length = 441 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 342 ADELGDQAGEIPQVGGAKVSKKRNYSF 422 A+ LG AG++P GGA + R++ F Sbjct: 73 ANSLGHHAGQVPSYGGAAFNSTRDFLF 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,118,054 Number of Sequences: 219361 Number of extensions: 1109451 Number of successful extensions: 2787 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2787 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)