| Clone Name | bags35g17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POL2_BRAV (Q9YK98) RNA2 polyprotein (P2) [Contains: P2A protein;... | 28 | 6.7 | 2 | MST2_DROHY (Q08696) Axoneme-associated protein mst101(2) | 28 | 8.8 |
|---|
>POL2_BRAV (Q9YK98) RNA2 polyprotein (P2) [Contains: P2A protein; Movement| protein (MP); Coat protein (CP)] Length = 1626 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 109 PMATLPLARRPAWVMMLPAVALVDALFLTSPELYA 5 P+ LPL PAW++ P A + L LT E +A Sbjct: 154 PIPELPLWLAPAWMVEQPYAATPEVLCLTQREEFA 188
>MST2_DROHY (Q08696) Axoneme-associated protein mst101(2)| Length = 1391 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 26 KKQCVDECHSREHHHPSRASCERKCSHWRDPARKEQCVQQXMR 154 KKQC +E +E + CE + ++ A K+QC ++ + Sbjct: 1077 KKQC-EERAKKEKEAAEKKQCEERAKKLKEAAEKKQCEERAKK 1118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,639,171 Number of Sequences: 219361 Number of extensions: 410618 Number of successful extensions: 1333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1330 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)