| Clone Name | bags35e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PKD1_HUMAN (P98161) Polycystin-1 precursor (Autosomal dominant p... | 31 | 0.75 | 2 | K0323_MOUSE (Q80U38) Protein KIAA0323 | 30 | 1.3 | 3 | SGS3_DROSI (P13729) Salivary glue protein Sgs-3 precursor | 28 | 6.4 | 4 | CB010_HUMAN (Q7Z570) Protein C2orf10 | 28 | 8.3 |
|---|
>PKD1_HUMAN (P98161) Polycystin-1 precursor (Autosomal dominant polycystic kidney| disease protein 1) Length = 4303 Score = 31.2 bits (69), Expect = 0.75 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 94 AHVCLQHLHGAQSSHPAGPPRRTQ 165 AHV L ++HG QSS GPPR Q Sbjct: 3728 AHVLLPYVHGNQSSPELGPPRLRQ 3751
>K0323_MOUSE (Q80U38) Protein KIAA0323| Length = 671 Score = 30.4 bits (67), Expect = 1.3 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 106 LQHLHGAQSSHPA--GPPRRTQCGWXQG-ADPQRARRERGDKQQ 228 LQ LH +S P PP + W G D R R +RGDKQQ Sbjct: 340 LQRLHNGSASPPRVPSPPPAPEPPWPCGDRDRDRDRGDRGDKQQ 383
>SGS3_DROSI (P13729) Salivary glue protein Sgs-3 precursor| Length = 217 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 72 GCASKRKSSCLPTTSPWC-SEQPSSWAS*THSVRLXARR*PPT 197 GC +K ++C P T P C S ++ + T + R PPT Sbjct: 27 GCPTKATTTCAPPTKPTCKSTSTTTTTTTTTTTTTTTTRAPPT 69
>CB010_HUMAN (Q7Z570) Protein C2orf10| Length = 1209 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 193 GGQRLAXSRTECV*EAQLDGCSEHHGDVVGKHELLRLEAQPIV 65 G L SRT C + ++ CS+ H +V ++++ R+ V Sbjct: 712 GKHNLTYSRTYCCWKTKMSSCSQDHRSLVLQNDMKRMSQNQAV 754 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,090,665 Number of Sequences: 219361 Number of extensions: 464770 Number of successful extensions: 1206 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1206 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)