| Clone Name | bags34m06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLAP2_CAEEL (Q02328) Protein SLA2 homolog | 30 | 5.9 | 2 | O1082_RAT (P23268) Olfactory receptor 1082 (Olfactory receptor-l... | 30 | 5.9 | 3 | ASSY_SHEON (Q8EK28) Argininosuccinate synthase (EC 6.3.4.5) (Cit... | 30 | 5.9 |
|---|
>SLAP2_CAEEL (Q02328) Protein SLA2 homolog| Length = 927 Score = 30.0 bits (66), Expect = 5.9 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 588 PTETDYKCLNRPLTRVLHRWKHIEQAGYKPFIQRKLPQKKQKI-IHNVFP 442 P ET Y+ +NR T++ WKH+ +GY P I+ ++ HN +P Sbjct: 86 PEET-YRYVNR-FTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYP 133
>O1082_RAT (P23268) Olfactory receptor 1082 (Olfactory receptor-like protein| F12) Length = 317 Score = 30.0 bits (66), Expect = 5.9 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +1 Query: 400 YLDYWSALCFGIVAGEYIVYYLLLFLWKFSLYERFVASLLNMLPSVQYSGERSV*AFIVG 579 Y+ LC+ ++ + LLL W S++ F+ SL+ + + + G+ + F Sbjct: 124 YVAXCHPLCYTVIVNHRLCILLLLLSWVISIFHAFIQSLIVL--QLTFCGDVKIPHF--- 178 Query: 580 FCWL--VRNLLCGHSWKFH 630 FC L + L C ++ H Sbjct: 179 FCELNQLSQLTCSDNFPSH 197
>ASSY_SHEON (Q8EK28) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 407 Score = 30.0 bits (66), Expect = 5.9 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -1 Query: 172 IYHTPSTCFHWHHDEGGLRDTWTSCSSGPARCLGTIISRP--VPDSSQYASRVASSG 8 IY + FH H+ G L D W P++ + T+ + P P+ ++Y S +G Sbjct: 183 IYSRDANAFHISHEGGELEDPWNE----PSKGVWTLTADPEDAPNQAEYVSLEVENG 235 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,942,385 Number of Sequences: 219361 Number of extensions: 1979895 Number of successful extensions: 5039 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5037 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)