| Clone Name | bags34k17 |
|---|---|
| Clone Library Name | barley_pub |
>GSH1_ARATH (P46309) Glutamate--cysteine ligase, chloroplast precursor (EC| 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS) Length = 522 Score = 127 bits (320), Expect = 1e-29 Identities = 61/78 (78%), Positives = 69/78 (88%) Frame = +2 Query: 2 PVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLLNL 181 PVTGLKTPFRDG ++ +AEDVL+LAK+GLERRGYKE GFL VDEVVRTGVTPAEKLL + Sbjct: 445 PVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLLEM 504 Query: 182 YETKWQRSVDPVFEELLY 235 Y +W +SVDPVFEELLY Sbjct: 505 YNGEWGQSVDPVFEELLY 522
>GSH1_BRAJU (O23736) Glutamate--cysteine ligase, chloroplast precursor (EC| 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS) Length = 514 Score = 123 bits (309), Expect = 2e-28 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = +2 Query: 2 PVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLLNL 181 PVTGLKTPFRDG ++ +AEDVL+LAK+GLERRGYKEVGFL V EVVRTGVTPAE LL + Sbjct: 437 PVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLLEM 496 Query: 182 YETKWQRSVDPVFEELLY 235 Y +W +SVDPVF+ELLY Sbjct: 497 YNGEWGQSVDPVFQELLY 514
>GSH1_LYCES (O22493) Glutamate--cysteine ligase, chloroplast precursor (EC| 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS) Length = 523 Score = 118 bits (296), Expect = 6e-27 Identities = 56/78 (71%), Positives = 66/78 (84%) Frame = +2 Query: 2 PVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLLNL 181 P +GLKTPFRDG + +A+DV++LAK GLERRG+KE GFL EV EVV+TGVTPAEKLL L Sbjct: 446 PKSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFKETGFLNEVAEVVKTGVTPAEKLLEL 505 Query: 182 YETKWQRSVDPVFEELLY 235 Y KW +SVDP+FEELLY Sbjct: 506 YHGKWGQSVDPIFEELLY 523
>GSH1_MEDTR (Q9ZNX6) Glutamate--cysteine ligase, chloroplast precursor (EC| 6.3.2.2) (Gamma-glutamylcysteine synthetase) (Gamma-ECS) (GCS) Length = 508 Score = 116 bits (291), Expect = 2e-26 Identities = 56/77 (72%), Positives = 67/77 (87%) Frame = +2 Query: 5 VTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLLNLY 184 VTGLKTPFRDG ++ +AE+VL+LAK+GLERRG+KE GFL V EVVRTGVTPAE+LL LY Sbjct: 432 VTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFKESGFLNAVAEVVRTGVTPAERLLELY 491 Query: 185 ETKWQRSVDPVFEELLY 235 KW++SVD VF+ELLY Sbjct: 492 HGKWEQSVDHVFDELLY 508
>NUDH_ZYMMO (Q9RH11) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 155 Score = 33.9 bits (76), Expect = 0.20 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +2 Query: 47 DLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLLNLYETKW 196 D+ E+ Q+ + GLE + EVG LRE++E TG+ P + + +W Sbjct: 28 DMKEEAWQMPQGGLEAKETPEVGVLRELEE--ETGIPPRMVAIISHTKEW 75
>ACDS_MEGEL (Q06319) Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)| (SCAD) (Butyryl-CoA dehydrogenase) (BCAD) Length = 383 Score = 31.6 bits (70), Expect = 1.0 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 8/117 (6%) Frame = +2 Query: 32 DGYVRDLAEDVLQLAKNGLER--------RGYKEVGFLREVDEVVRTGVTPAEKLLNLYE 187 D + D+ +D L+LA + E+ R +K + +DE++ G+T A +E Sbjct: 2 DFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYDKELIDELLSLGITGA-----YFE 56 Query: 188 TKWQRSVDPVFEELLY*YTESHITSVDAGQGGQGLQTVSLYKNPVLNSTSHLTRETY 358 K+ S D + L Y + DAG TVSL NP+ + +E + Sbjct: 57 EKYGGSGDDGGDVLSYILAVEELAKYDAGVAITLSATVSLCANPIWQFGTEAQKEKF 113
>CCNB3_CANFA (Q659K0) G2/mitotic-specific cyclin-B3| Length = 1330 Score = 30.8 bits (68), Expect = 1.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 321 TGFLYRDTV*RPCPPCPASTEVICDSVYQ 235 T FL PCPPC ICD +YQ Sbjct: 1152 TAFLIAAKFEEPCPPCVDDFLYICDDIYQ 1180
>IKAR_MOUSE (Q03267) DNA-binding protein Ikaros (Lymphoid transcription factor| LyF-1) Length = 517 Score = 30.0 bits (66), Expect = 2.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 286 GSSDCIPVQKSRPQFHKPPDEG 351 GSS+ +PV S Q HKPP +G Sbjct: 332 GSSEVVPVISSMYQLHKPPSDG 353
>U520_CAEEL (Q9U2G0) Putative U5 small nuclear ribonucleoprotein 200 kDa helicase| (EC 3.6.1.-) Length = 2145 Score = 29.6 bits (65), Expect = 3.8 Identities = 19/80 (23%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +2 Query: 56 EDVLQLAKNGLERRGYKEVGFLREVD---EVVRTGVTPAEKLLNLYETKWQRSVDPVFEE 226 E+V+ A NG + E+ LR + E +TP E + W+R ++P Sbjct: 1338 ENVIVCAPNGSGKTAIAELAVLRHFENTPEAKAVYITPMEDMATKVYADWKRRLEPAIGH 1397 Query: 227 LLY*YTESHITSVDAGQGGQ 286 + T + Q GQ Sbjct: 1398 TIVLLTGEQTMDLKLAQRGQ 1417
>VG29_BPMU (Q9T1W5) Protein gp29| Length = 512 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 80 NGLERRGYKEVGFLREVDEVVRTGVTPAEKLLNLYETKWQRSVDPVFEELLY 235 NG ++ + + D++ R GV+P + WQRSVDP+ + +++ Sbjct: 421 NGSQKEAALSAEDIPQEDDIDRMGVSPED---------WQRSVDPLLKPVIF 463
>SYFB_PSEPK (Q88K22) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 793 Score = 29.3 bits (64), Expect = 5.0 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +3 Query: 159 LLRSF*IYTRRSGSAAWTPSSRSCYIDTLNHI*LRWTLDKVDRVFRLYPCTKIPSSIPQA 338 LL + + T +SG WT S S D + +D ++ + RLY +P PQA Sbjct: 429 LLNALELTTTKSGEGQWTVSVPSHRFD------ISLEVDLIEELARLYGYNNLPVRYPQA 482 Query: 339 --T*RGKP 356 +GKP Sbjct: 483 RLAPQGKP 490
>CHIA_BOVIN (Q95M17) Acidic mammalian chitinase precursor (EC 3.2.1.14)| (AMCase) (Chitin-binding protein b04) (CBPb04) Length = 472 Score = 28.9 bits (63), Expect = 6.6 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 211 PRLRGVVILIH*ITYNFGGRWTRWTGSSDCIPVQKSRPQFHKPPDEGN 354 P+L + IH +TY+F G W +TG ++ P + P D G+ Sbjct: 198 PQLSQYLDFIHVMTYDFHGSWEGYTG--------ENSPLYKYPTDTGS 237
>MTMR9_MOUSE (Q9Z2D0) Myotubularin-related protein 9| Length = 545 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -2 Query: 298 SLKTLSTLSSVHRSYM*FSVSI*QLLEDGVHAALP 194 S++ LSTL SV Y F + +++EDG H+ LP Sbjct: 95 SIEALSTLDSVTLMYPFFYRPMFEVIEDGWHSFLP 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,201,452 Number of Sequences: 219361 Number of extensions: 1306073 Number of successful extensions: 3652 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3651 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)