ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags34i17 |
|---|---|
| Clone Library Name | barley_pub |
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 101 bits (252), Expect = 5e-22 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +1 Query: 10 TVTAKGTTTFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 TVTA+ T F DLS+DIE NSSITSCLKNFSSTETL+AEDKFFCDKCCSLQEAQKRMKI Sbjct: 186 TVTARDET-FLDLSLDIEQNSSITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKI 243
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 101 bits (252), Expect = 5e-22 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +1 Query: 10 TVTAKGTTTFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 TVTA+ T F DLS+DIE NSSITSCLKNFSSTETL+AEDKFFCDKCCSLQEAQKRMKI Sbjct: 191 TVTARDET-FLDLSLDIEQNSSITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKI 248
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/59 (59%), Positives = 48/59 (81%) Frame = +1 Query: 10 TVTAKGTTTFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 TV++K F DLSVD+E N+SIT CL++FS+TETL +E K++C+ CCS QEAQKRM++ Sbjct: 187 TVSSKDED-FLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRV 244
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/59 (59%), Positives = 48/59 (81%) Frame = +1 Query: 10 TVTAKGTTTFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 TV++K F DLSVD+E N+SIT CL++FS+TETL +E K++C+ CCS QEAQKRM++ Sbjct: 187 TVSSKDED-FLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRV 244
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 71.2 bits (173), Expect = 7e-13 Identities = 31/51 (60%), Positives = 45/51 (88%) Frame = +1 Query: 34 TFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 +F DLS+DIE ++S+TSCL++FS++E L++++KF CD C SLQEA+KRMKI Sbjct: 256 SFLDLSIDIENHTSVTSCLRSFSASEMLSSKNKFHCDVCKSLQEAEKRMKI 306
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 37 FFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 F DLSVD+E N+SIT CL+ FS+TETL +E K++C++C S QEA KRMK+ Sbjct: 184 FLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKV 233
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 68.6 bits (166), Expect = 4e-12 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +1 Query: 10 TVTAKGTTTFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 TV++K F DLS+D+E N+SI+ CL+ FS TETL + K+FC+ C S QEAQKRM+I Sbjct: 216 TVSSKDED-FLDLSIDVEQNTSISHCLRVFSETETLCGDQKYFCETCSSKQEAQKRMRI 273
>UBP13_YEAST (P38187) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) Length = 688 Score = 45.8 bits (107), Expect = 3e-05 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +1 Query: 40 FDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK 174 F + V + + I LK++ E LN +KF+CD+CC LQEA++ Sbjct: 504 FPIEVQGDEETDIQEILKSYHQREMLNGSNKFYCDECCGLQEAER 548
>UBP38_MOUSE (Q8BW70) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) Length = 1042 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +1 Query: 61 EXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 E +S+T L F + E L E++++C+ C SLQ A+K M+I Sbjct: 713 ESTTSVTDLLNYFLAPEVLTGENQYYCESCASLQNAEKTMQI 754
>UBP9_YEAST (P39967) Ubiquitin carboxyl-terminal hydrolase 9 (EC 3.1.2.15)| (Ubiquitin thioesterase 9) (Ubiquitin-specific-processing protease 9) (Deubiquitinating enzyme 9) Length = 754 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 40 FDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK 174 F + V + + I LK++ E LN +KF+C+KC LQEA++ Sbjct: 503 FPIEVQGDEETDIQKMLKSYHQREMLNGVNKFYCNKCYGLQEAER 547
>UBP38_HUMAN (Q8NB14) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) (HP43.8KD) Length = 1042 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = +1 Query: 61 EXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 E S+T L F + E L +++++C+ C SLQ A+K M+I Sbjct: 713 ETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQI 754
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/42 (35%), Positives = 28/42 (66%) Frame = +1 Query: 61 EXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 E + S+ + F S E L AE++++C+ C SLQ+A+K +++ Sbjct: 755 EGSRSVLDLVNYFLSPEKLTAENRYYCESCASLQDAEKVVEL 796
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 38.5 bits (88), Expect = 0.005 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +1 Query: 31 TTFFDLSVDIEXNSSIT--SCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 T D D E + +IT CL F TE L ED ++C C ++A K+M+I Sbjct: 810 TILSDKKDDSEDSRTITLNDCLDEFEKTEQLGEEDPWYCPTCKEFRQASKQMEI 863
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 37.7 bits (86), Expect = 0.008 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 58 IEXNSSITSCLKNFSSTETLNAEDKFFCDKCCS 156 IE ++ CLKNF+ E L+ E+ F C+ CC+ Sbjct: 670 IEEPKTLIDCLKNFTHVEELSGENMFACENCCN 702
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 35.8 bits (81), Expect = 0.032 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +1 Query: 37 FFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 F DLS+DI+ + CL +F E L + + C +C S Q+A K++ I Sbjct: 303 FLDLSLDIKDKKKLYECLDSFHKKEQLK-DFNYHCGECNSTQDAIKQLGI 351
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 35.4 bits (80), Expect = 0.042 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +1 Query: 37 FFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKC 150 F SVDI +SS+T L+ + E L D + CDKC Sbjct: 1852 FSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKC 1889
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 33.5 bits (75), Expect = 0.16 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 ++ CL FS E L+ +D ++C C + + A KR++I Sbjct: 691 TLEDCLLEFSKPEQLDLQDSWYCPGCKAFRPATKRLEI 728
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 76 ITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 + C++ F++ E L AED ++C C Q+A K++ + Sbjct: 788 LKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDL 824
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 76 ITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 + C++ F++ E L AED ++C C Q+A K++ + Sbjct: 788 LKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDL 824
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 37 FFDLSVDIEXNSSIT--SCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 F LS+ + S T CL+ FS E L ++F+C C + +++ K+++I Sbjct: 949 FMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEI 1000
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 37 FFDLSVDIEXNSSIT--SCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 F LS+ + S T CL+ FS E L ++F+C C + +++ K+++I Sbjct: 911 FMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEI 962
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 32.3 bits (72), Expect = 0.35 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 14/64 (21%) Frame = +1 Query: 37 FFDLSVDIEXN--------------SSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK 174 F DLS+DI S+ CL++F+ E L+ + + C KC Q++ K Sbjct: 337 FLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTK 396 Query: 175 RMKI 186 + I Sbjct: 397 KFWI 400
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 32.3 bits (72), Expect = 0.35 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 14/64 (21%) Frame = +1 Query: 37 FFDLSVDIEXN--------------SSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK 174 F DLS+DI S+ CL++F+ E L+ + + C KC Q++ K Sbjct: 338 FLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTK 397 Query: 175 RMKI 186 + I Sbjct: 398 KFWI 401
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 32.0 bits (71), Expect = 0.46 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +1 Query: 37 FFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 + D++++I ++I L+ F + L+ E+ + C KC A KR I Sbjct: 268 YLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCKKKVPASKRFTI 317
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 32.0 bits (71), Expect = 0.46 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 76 ITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 + C+K F++ ETL E+ ++C C Q A K++ + Sbjct: 616 LKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDL 652
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 31.6 bits (70), Expect = 0.61 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 37 FFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 F D+ +DI S+ L + +E L ++ ++C KC A K + + Sbjct: 193 FLDIPLDISSAQSVKQALWDTEKSEELCGDNAYYCGKCRQKMPASKTLHV 242
>UBP1_HUMAN (O94782) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) (hUBP) Length = 785 Score = 31.2 bits (69), Expect = 0.79 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 88 LKNFSSTETLNAEDKFFCDKCCSLQEAQKRM 180 + F+S E + EDK+FC+ C EA++ + Sbjct: 489 ISQFASVERIVGEDKYFCENCHHYTEAERSL 519
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 31.2 bits (69), Expect = 0.79 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 ++ C++ F++ ETL D ++C C Q+A K+ + Sbjct: 777 ALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDL 814
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 30.8 bits (68), Expect = 1.0 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 ++ C++ F++ ETL D ++C C Q+A K+ + Sbjct: 776 ALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDL 813
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 ++ SCL+ F+S E L + ++C KC + A K++ + Sbjct: 1032 NLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDL 1069
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 76 ITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 + C++ F++ ETL E+ +FC C Q A K++ + Sbjct: 263 LQECIELFTTVETLEKENPWFCPTCKQHQLATKKLDL 299
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 ++ SCL+ F+S E L + ++C KC + A K++ + Sbjct: 1234 NLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDL 1271
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 34 TFFDLSVDIEX---NSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 T LS+ ++ ++ CL+ + S ETL+A++ + C+ C +A K+ K+ Sbjct: 299 THLSLSIPVKNMYEQLNVYDCLREYFSQETLDADNLWNCEGCHEKVQAIKKTKL 352
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 34 TFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 +F L+VDI + ++ L+ + + L + + C+KC + KR+ I Sbjct: 1736 SFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLI 1786
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 61 EXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 E ++ CL+ FS E L D ++C C ++A K++++ Sbjct: 959 ERTITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATKQIQL 1000
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 30.0 bits (66), Expect = 1.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 76 ITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 + C++ F++ ETL E+ ++C C Q A K++ + Sbjct: 738 LQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDL 774
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 34 TFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 +F L+VDI + ++ L+ + + L + + C+KC + KR+ I Sbjct: 1729 SFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLI 1779
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 34 TFFDLSVDIEXNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 +F L+VDI + ++ L+ + + L + + C+KC + KR+ I Sbjct: 1738 SFTTLNVDIRNHQNLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLI 1788
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = +1 Query: 34 TFFDLSVDIE------XNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK 174 TF D+ + + SI L+ F ETL+ +++ C+KC +A K Sbjct: 529 TFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHK 581
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKI 186 S+ +CL+ F E L ++ +FC +C ++A K++ + Sbjct: 769 SLYACLEAFLREEPLVPDEMWFCPQCNERRQASKKLDL 806
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 73 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRM 180 ++ CL F+ E L E+ ++C +C +EA K++ Sbjct: 1112 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQL 1147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,174,452 Number of Sequences: 219361 Number of extensions: 265762 Number of successful extensions: 983 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
