| Clone Name | bags34b23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRB8_YEAST (P25648) Suppressor of RNA polymerase B SRB8 | 31 | 2.3 | 2 | COX2_TRIRU (Q01556) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) ... | 30 | 5.0 | 3 | EX5B_BUCAP (Q8K9A9) Exodeoxyribonuclease V beta chain (EC 3.1.11.5) | 29 | 8.6 | 4 | SRB11_CAEEL (P46506) Serpentine receptor class beta-11 (Protein ... | 29 | 8.6 |
|---|
>SRB8_YEAST (P25648) Suppressor of RNA polymerase B SRB8| Length = 1427 Score = 31.2 bits (69), Expect = 2.3 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 6/109 (5%) Frame = -3 Query: 467 VSIYSLKKNASEAMGHLENMPEYACMLQRKLKTIISI*VQYVHCSNI*HTH-S*SFPKIQ 291 + +YS+ N+++A+G N PE + Q ++ ++ H S I T+ S F K + Sbjct: 827 LKVYSMINNSNQAVGQTWNFPE---VFQVNIRFLL-------HNSEIIDTNTSKQFQKAR 876 Query: 290 NHKYF-----IRTWNRFMNKIIHGS*FPNTNRLTPVLNHNLLTISVSNS 159 N+ ++ +N+FM+ + F N N L +++ LLT V+ + Sbjct: 877 NNVMLLIATNLKEYNKFMSIFLKRKDFTNKN-LIQLISLKLLTFEVTQN 924
>COX2_TRIRU (Q01556) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 237 Score = 30.0 bits (66), Expect = 5.0 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -2 Query: 390 VTEKTENYYFYISTVCSLLKYITYTFIKLSKNSKS*IFHSYMEQIYEQNNPWIIVP 223 + E N FY++ + + ++ T IK N+KS I H YM W I P Sbjct: 24 IEELHNNIMFYLTIILFSVTWMMITIIKSFVNTKSPISHKYMNHGTLIELIWTITP 79
>EX5B_BUCAP (Q8K9A9) Exodeoxyribonuclease V beta chain (EC 3.1.11.5)| Length = 1179 Score = 29.3 bits (64), Expect = 8.6 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 315 FIKLSKNSKS*IFHSYMEQIYEQNNPW 235 F K+ +NSK+ I H ++++YE N+ W Sbjct: 635 FQKIKENSKTKISHFLIQKLYEYNDKW 661
>SRB11_CAEEL (P46506) Serpentine receptor class beta-11 (Protein srb-11)| Length = 346 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -2 Query: 381 KTENYYFYISTVCSLLKYITYTFIKLSKNSKS*IFHSYMEQIY 253 + NYY I + CS+ I + KLSK+S FH ++ I+ Sbjct: 21 QASNYYQMIISFCSVFPLIYFLLFKLSKSS----FHGNLKTIF 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,395,054 Number of Sequences: 219361 Number of extensions: 1763960 Number of successful extensions: 3846 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3845 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)