| Clone Name | bags34b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor... | 29 | 4.4 | 2 | FTHS_ENTFA (Q834D6) Formate--tetrahydrofolate ligase (EC 6.3.4.3... | 28 | 7.6 | 3 | SPE2C_STRPU (P04111) SPEC 2C protein | 28 | 9.9 | 4 | MUC_CANFA (P01874) Ig mu chain C region | 28 | 9.9 |
|---|
>ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor (ICAM-2)| (CD102 antigen) Length = 275 Score = 29.3 bits (64), Expect = 4.4 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = +1 Query: 175 STTCLTGS-GKRSEFLSVLLVSQEAAWKRYCP---SYDAIFVCK*YCQRKTEFISSSL 336 STTC G L+ +L+ ++A WK Y S+D + C C K E ++S++ Sbjct: 49 STTCNQPEVGGLETSLNKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNV 106
>FTHS_ENTFA (Q834D6) Formate--tetrahydrofolate ligase (EC 6.3.4.3)| (Formyltetrahydrofolate synthetase) (FHS) (FTHFS) Length = 556 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 36 EKLVQKQQYFQNLSKHIHLKGRYDAVISVAI 128 E L Q+ F NL KHI RYD + VAI Sbjct: 348 ENLPALQKGFANLEKHIQNMQRYDVPVVVAI 378
>SPE2C_STRPU (P04111) SPEC 2C protein| Length = 151 Score = 28.1 bits (61), Expect = 9.9 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = -1 Query: 236 DTSKTDRNSLLFPDPVRHVV----DPTTNHEQAGASKRKGNGNGDDRIVTAFKVDML 78 D TD++ L P+ +R + DP E+ A +K +GN D I A V M+ Sbjct: 91 DALDTDKSGSLSPEELRTALSACTDPPMTKEEIDAIIKKADGNNDGEIRRAEFVRMI 147
>MUC_CANFA (P01874) Ig mu chain C region| Length = 450 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 316 QSFSDNIICKRRWHHSLGSIASMPLPEILAKPTEIHSFFP 197 Q ++I+CK R H +PLP +L P E+ F P Sbjct: 79 QGTDEHIVCKVR-HSBGBKQKBVPLPVMLTLPPEVSGFIP 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,480,876 Number of Sequences: 219361 Number of extensions: 1239689 Number of successful extensions: 2937 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2937 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)