| Clone Name | bags34b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRY1_ARATH (Q43125) Cryptochrome-1 (Blue light photoreceptor) | 75 | 6e-14 | 2 | CRY2_ARATH (Q96524) Cryptochrome-2 (Blue light photoreceptor) | 63 | 2e-10 | 3 | PHR1_SINAL (P40115) Deoxyribodipyrimidine photo-lyase (EC 4.1.99... | 58 | 6e-09 |
|---|
>CRY1_ARATH (Q43125) Cryptochrome-1 (Blue light photoreceptor)| Length = 681 Score = 74.7 bits (182), Expect = 6e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +3 Query: 3 VFHLVRMKQLVWSNEGNHAAEESCTLFLRSVGLREYSRYLCFNH 134 VFHLVR+KQ+ W+NEGN A EES LFL+S+GLREYSRY+ FNH Sbjct: 264 VFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYSRYISFNH 307
>CRY2_ARATH (Q96524) Cryptochrome-2 (Blue light photoreceptor)| Length = 612 Score = 62.8 bits (151), Expect = 2e-10 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 3 VFHLVRMKQLVWSNEGNHAAEESCTLFLRSVGLREYSRYLCFN 131 VF RMKQ++W+ + N EES LFLR +GLREYSRY+CFN Sbjct: 261 VFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFN 303
>PHR1_SINAL (P40115) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 501 Score = 58.2 bits (139), Expect = 6e-09 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +3 Query: 3 VFHLVRMKQLVWSNEGNHAAEESCTLFLRSVGLREYSRYLCFN 131 VF RMKQ++W+ + N EES LFLR +GLR+YSR +CFN Sbjct: 260 VFQCARMKQIIWARDKNGEGEESADLFLRGIGLRDYSRIICFN 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,816,842 Number of Sequences: 219361 Number of extensions: 405147 Number of successful extensions: 1662 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1662 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)