| Clone Name | bags33c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXT2_CAEEL (O01705) Exostosin-2 (EC 2.4.1.223) (EC 2.4.1.224) (G... | 32 | 1.7 | 2 | IF2_CHLAB (Q5L627) Translation initiation factor IF-2 | 31 | 2.2 | 3 | KUP_PSEPK (Q88NK7) Probable potassium transport system protein kup | 29 | 8.2 |
|---|
>EXT2_CAEEL (O01705) Exostosin-2 (EC 2.4.1.223) (EC 2.4.1.224)| (Glucuronyl-galactosyl-proteoglycan/Glucuronosyl-N- acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Multiple exostoses homolog 2) Length = 814 Score = 31.6 bits (70), Expect = 1.7 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 8/98 (8%) Frame = -3 Query: 378 LNPKVSYRPSWAVNISRRRPGTTKACLL--ASTVLFITPYEQPFSD------LGECKLVS 223 L+ + S RP V S+ + L +ST F+ P E F D LG ++ Sbjct: 304 LSAEPSRRPIVIVKCSQENCSLERRRQLIGSSTFCFLLPSEMFFQDFLSSLQLGCIPIIL 363 Query: 222 GLPSLAPLNQLQHRFRQTYRPPVSLIPSPRRYLQSYQL 109 L P L R TYR P++ +P +QS+++ Sbjct: 364 SNSQLLPFQDLIDWRRATYRLPLARLPEAHFIVQSFEI 401
>IF2_CHLAB (Q5L627) Translation initiation factor IF-2| Length = 874 Score = 31.2 bits (69), Expect = 2.2 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 247 PRRM*AGFGSSFAGPPKSVTAPFSADLPSAGFSDPV 140 PRR+ A SSFA ++ +P S D S FS PV Sbjct: 73 PRRIRAKNRSSFASEDSTIPSPVSVDTESTAFSPPV 108
>KUP_PSEPK (Q88NK7) Probable potassium transport system protein kup| Length = 636 Score = 29.3 bits (64), Expect = 8.2 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -3 Query: 363 SYRPSWAVNISRRRPGTTKACLLASTVLFITPYEQPFSDLG 241 ++ P+WAVN PG A +L + VL +T E ++D+G Sbjct: 211 AFNPAWAVNFFVVHPGIGVA-ILGAVVLALTGAEALYADMG 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,032,695 Number of Sequences: 219361 Number of extensions: 1396416 Number of successful extensions: 3400 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3399 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)