| Clone Name | bags32l16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL18_MYCGE (P47413) 50S ribosomal protein L18 | 30 | 7.1 | 2 | HPLN2_HUMAN (Q9GZV7) Hyaluronan and proteoglycan link protein 2 ... | 29 | 9.3 | 3 | CRUM2_HUMAN (Q5IJ48) Crumbs homolog 2 precursor (Crumbs-like pro... | 29 | 9.3 |
|---|
>RL18_MYCGE (P47413) 50S ribosomal protein L18| Length = 115 Score = 29.6 bits (65), Expect = 7.1 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -2 Query: 365 KVRRVDMDTRVVILPYIESTYWSSHSWLYTKRCKLTLDEMIQLPLSTLNKGGAGL 201 K+R +++ RVV++ S +W ++K LT +QL L NK A L Sbjct: 17 KIRLTNLNNRVVLIVIKSLKNISVQAWDFSKNVVLTSSSSLQLKLKNGNKENAKL 71
>HPLN2_HUMAN (Q9GZV7) Hyaluronan and proteoglycan link protein 2 precursor| (Brain link protein 1) Length = 340 Score = 29.3 bits (64), Expect = 9.3 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 83 PCCYGLPNPGDSSFMFSRP--GAWHSSCFCSS 172 P C GLP+PG SF F RP A+ + C+ + Sbjct: 309 PRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN 340
>CRUM2_HUMAN (Q5IJ48) Crumbs homolog 2 precursor (Crumbs-like protein 2)| Length = 1285 Score = 29.3 bits (64), Expect = 9.3 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 146 WHSSCFCSSLCTANGPLCLAPPHLCLELRVVVESSRPG*ACSALCI 283 WH C + LC A+GP+ LA L + S++ G A A C+ Sbjct: 536 WHEGC-PARLCVASGPVALASTASATPLPAGISSAQLGDATFAGCL 580 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,322,434 Number of Sequences: 219361 Number of extensions: 1629222 Number of successful extensions: 3958 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3958 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)