| Clone Name | bags32g09 |
|---|---|
| Clone Library Name | barley_pub |
>KLF16_HUMAN (Q9BXK1) Krueppel-like factor 16 (Transcription factor BTEB4)| (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor NSLP2) Length = 252 Score = 32.3 bits (72), Expect = 1.2 Identities = 19/50 (38%), Positives = 22/50 (44%) Frame = +1 Query: 16 GPVGPGEVPVLDVNAANRHASLQELQTPPPAGDLALYESPHLSVAPNKAA 165 GP G G LDV AA R A+ PPP A P + AP+ A Sbjct: 31 GPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGPGAAAAPHLLA 80
>FIXI_BRAJA (Q59207) Nitrogen fixation protein fixI (E1-E2 type cation ATPase| fixI) (EC 3.6.3.-) Length = 730 Score = 32.3 bits (72), Expect = 1.2 Identities = 24/61 (39%), Positives = 31/61 (50%) Frame = -3 Query: 384 APAPVSDQQRAAPVSGAHAPWPVDDLILLGRHLDHPIPAPVSAAILVAPFAAVLPRPDLH 205 AP+ + +P+S AH DL+ LGR L APV+AAI A A L R +L Sbjct: 627 APSLAAAHVSMSPISAAHLSQATADLVFLGRPL-----APVAAAIDSARKALHLMRQNLW 681 Query: 204 L 202 L Sbjct: 682 L 682
>FIBA_RAT (P06399) Fibrinogen alpha chain precursor [Contains: Fibrinopeptide| A] Length = 782 Score = 32.0 bits (71), Expect = 1.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 211 IWTRQDGGKGSDEDCGGDWRRDRVVEMTPEQNQIVDRPRC 330 +WT G + GGD R R+VE P Q + D P C Sbjct: 17 VWTADTGTTSEFIEAGGDIRGPRIVERQPSQCKETDWPFC 56
>ANR50_HUMAN (Q9ULJ7) Ankyrin repeat domain-containing protein 50| Length = 1375 Score = 31.2 bits (69), Expect = 2.7 Identities = 25/69 (36%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Frame = -3 Query: 474 DGHGGLVVAEAM---EVVRHLL-HGATFQMQDVHAPAPVSDQQRAAPVSGAHAPWPVDDL 307 +G L+ A M E+V HLL HGA +DV +S P S HA V L Sbjct: 622 EGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHAS-VVSLL 680 Query: 306 ILLGRHLDH 280 I G +DH Sbjct: 681 IDRGAEVDH 689
>IF2_DESDG (Q30WJ0) Translation initiation factor IF-2| Length = 984 Score = 31.2 bits (69), Expect = 2.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 205 VEIWTRQDGGKGSDEDCGGDWRRDRVVEMTPEQNQIVDRPR 327 VE + GGK ED GG+W R + + PE + +P+ Sbjct: 356 VEFGDKGAGGKKMREDVGGNWNRGKKGKRKPETKPVSTQPQ 396
>SCMH1_HUMAN (Q96GD3) Polycomb protein SCMH1 (Sex comb on midleg homolog 1)| Length = 660 Score = 30.8 bits (68), Expect = 3.5 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 88 LQTPPPAGDLALYESPHLSVAPNKAATLSSLCLSSQDPQVEIWTRQDGGKGSDED 252 L PPPA P S P AAT+ S + Q P V I+ ++G G D Sbjct: 322 LLNPPPASPTTSTPEPDTSTVPQDAATIPSSAM--QAPTVCIYLNKNGSTGPHLD 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,558,043 Number of Sequences: 219361 Number of extensions: 1621061 Number of successful extensions: 5607 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5600 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)