| Clone Name | bags32d22 |
|---|---|
| Clone Library Name | barley_pub |
>STS3_ARATH (P92976) Strictosidine synthase 3 precursor (EC 4.3.3.2) (SS-3)| Length = 329 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = +1 Query: 4 SNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLF 120 S G ++S DGSF + + ++ + RYW+KG KAGT + F Sbjct: 206 SAGCAVSSDGSFVLVGQFTKSNIKRYWIKGSKAGTSEDF 244
>STS1_ARATH (P94111) Strictosidine synthase 1 precursor (EC 4.3.3.2) (SS-1)| Length = 335 Score = 39.3 bits (90), Expect = 0.003 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +1 Query: 4 SNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLF 120 S G ++S DGSF + + ++ + RYW+KG KAG+ + F Sbjct: 204 SAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPKAGSSEDF 242
>STSY_CATRO (P18417) Strictosidine synthase precursor (EC 4.3.3.2)| Length = 352 Score = 37.0 bits (84), Expect = 0.015 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 1 ISNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVD 114 + G +S DGSF V E R+ +YWL+G K G+ + Sbjct: 214 VPGGAEISADGSFVVVAEFLSNRIVKYWLEGPKKGSAE 251
>APMAP_MOUSE (Q9D7N9) Adipocyte plasma membrane-associated protein (Protein| DD16) Length = 415 Score = 28.9 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 7 NGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLF 120 NGV LS + F + E + R+ R ++ G G D+F Sbjct: 259 NGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMF 296
>APMAP_HUMAN (Q9HDC9) Adipocyte plasma membrane-associated protein (BSCv| protein) Length = 416 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 7 NGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLF 120 NGV LS F + E + R+ R ++ G G DLF Sbjct: 260 NGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLF 297
>YPFJ_ECOLI (P64429) Hypothetical protein ypfJ| Length = 287 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -1 Query: 114 IDGSCLLTFQPVSAQPSTRSFTEDEE 37 +D + L+T QPVS Q STRS + +E+ Sbjct: 52 VDLTGLMTGQPVSQQQSTRSISPNED 77
>YPFJ_ECOL6 (P64430) Hypothetical protein ypfJ| Length = 287 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -1 Query: 114 IDGSCLLTFQPVSAQPSTRSFTEDEE 37 +D + L+T QPVS Q STRS + +E+ Sbjct: 52 VDLTGLMTGQPVSQQQSTRSISPNED 77
>YPFJ_ECO57 (P64431) Hypothetical protein ypfJ| Length = 287 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -1 Query: 114 IDGSCLLTFQPVSAQPSTRSFTEDEE 37 +D + L+T QPVS Q STRS + +E+ Sbjct: 52 VDLTGLMTGQPVSQQQSTRSISPNED 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,657,515 Number of Sequences: 219361 Number of extensions: 205736 Number of successful extensions: 730 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 80,573,946 effective HSP length: 15 effective length of database: 77,283,531 effective search space used: 1854804744 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)