ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags32c23 |
|---|---|
| Clone Library Name | barley_pub |
>Y393_PYRAB (Q9V1N4) UPF0278 protein PYRAB03930| Length = 204 Score = 31.6 bits (70), Expect = 1.7 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 464 IFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGL 568 ++I K PPN+ ++KIP + + +R +++GL Sbjct: 69 LYIIKKPPNVHDIKIPAFVVYELIEDIRRRVDKGL 103
>Y1839_PYRHO (O59517) UPF0278 protein PH1839| Length = 204 Score = 31.6 bits (70), Expect = 1.7 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 464 IFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGL 568 ++I K PPN+ ++KIP + + +R +++GL Sbjct: 69 LYIIKKPPNVHDIKIPAFVVYELIEDIRRRVDKGL 103
>Y1880_PYRFU (Q8TH04) UPF0278 protein PF1880| Length = 199 Score = 31.6 bits (70), Expect = 1.7 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 464 IFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGL 568 ++I K PPN+ ++KIP + + +R +++GL Sbjct: 67 LYIIKKPPNVHDIKIPAFVVYELIEDIRRRVDKGL 101
>RTN2_MOUSE (O70622) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 471 Score = 30.4 bits (67), Expect = 3.9 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 4/80 (5%) Frame = +2 Query: 299 ADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLA---TLFLWSNVCIF 469 ADL+ W++ + SG V G A L ++ + ++++ H +L L +L ++ V Sbjct: 273 ADLLYWKDTRTSGAVFTGLMASLLC--LLHFSIVSVAAHLALLGLCATISLRVYRKVLQA 330 Query: 470 IHKSPPNIP-EVKIPEDLTV 526 +H+ P + + DLT+ Sbjct: 331 VHRGDGTNPFQAYLDMDLTL 350
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 30.0 bits (66), Expect = 5.0 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 Query: 294 LPPPRTAWTGCSRPKRR*ILALTPAADP 211 LPPP+TAWT SRP PAA P Sbjct: 383 LPPPKTAWTENSRPSE-----TEPAAPP 405
>PK1L1_MOUSE (Q8R526) Polycystic kidney disease 1-like 1 protein| (Polycystin-1L1) (Fragment) Length = 531 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 385 HDLEQQPDGRSASEHPSGDLLVPP*NKISRLAAAEDGV 272 HD +PD R S HP+ DLL P ++ R+AA+ V Sbjct: 320 HDSSGRPDSRHPSPHPTSDLL-PWTDQAWRIAASSSAV 356
>RTN2_HUMAN (O75298) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 545 Score = 29.6 bits (65), Expect = 6.6 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 4/84 (4%) Frame = +2 Query: 287 GGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLA---TLFLWSN 457 G K ADL+ W++ + SG V G L ++ + ++++ H +L L +L ++ Sbjct: 342 GSKVADLLYWKDTRTSGVVFTGLMVSLLC--LLHFSIVSVAAHLALLLLCGTISLRVYRK 399 Query: 458 VCIFIHKSPPNIP-EVKIPEDLTV 526 V +H+ P + + DLT+ Sbjct: 400 VLQAVHRGDGANPFQAYLDVDLTL 423
>E434_ADEM1 (P23125) Probable early E4 33 kDa protein (ORF A/B protein)| Length = 289 Score = 29.3 bits (64), Expect = 8.6 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 Query: 407 VGHCLILSLATLFLWSNVCIFIHKSPPNIPEVKIPEDLTVNIALSLRH 550 V HC+ L TL W N+ + S P IP IP + T + + H Sbjct: 225 VDHCMRLLSFTLRRWQNLLLGRSGSSPLIPGFDIPRNRTERLRQRMLH 272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,042,521 Number of Sequences: 219361 Number of extensions: 924086 Number of successful extensions: 3161 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3159 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
