| Clone Name | bags31l06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZO2_HUMAN (Q9UDY2) Tight junction protein ZO-2 (Zonula occludens... | 33 | 0.49 | 2 | ZO2_CANFA (Q95168) Tight junction protein ZO-2 (Zonula occludens... | 32 | 1.4 | 3 | RIG_DROME (Q86BY9) Protein rigor mortis | 32 | 1.4 | 4 | GUNC_PSEFL (P27033) Endoglucanase C precursor (EC 3.2.1.4) (Endo... | 29 | 9.2 | 5 | YS89_CAEEL (Q09624) Hypothetical protein ZK945.9 | 29 | 9.2 |
|---|
>ZO2_HUMAN (Q9UDY2) Tight junction protein ZO-2 (Zonula occludens 2 protein)| (Zona occludens 2 protein) (Tight junction protein 2) Length = 1190 Score = 33.5 bits (75), Expect = 0.49 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -3 Query: 344 EASELGDRSCRRSHSGQPENHQYSAYRFHTNNDQIKGTP-RRSQPVIFLQERGLNPEDIQ 168 E ++ + RS S + HQYS Y +H++++++K P R L G P + Sbjct: 401 EIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFK 460 Query: 167 CAG 159 G Sbjct: 461 STG 463
>ZO2_CANFA (Q95168) Tight junction protein ZO-2 (Zonula occludens 2 protein)| (Zona occludens 2 protein) (Tight junction protein 2) Length = 1174 Score = 32.0 bits (71), Expect = 1.4 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -3 Query: 344 EASELGDRSCRRSHSGQPENHQYSAYRFHTNNDQIKGTPRRSQPVIFLQER-GLNPEDIQ 168 E ++ + RS S + QYS Y +H++N+++K P + + R G P + Sbjct: 385 EIEDISEIESNRSFSPEERRQQYSDYDYHSSNEKLKERPNSREDMQNRWSRMGATPTPFK 444 Query: 167 CAGIQGQILG 138 G ++G Sbjct: 445 SMGDIASVVG 454
>RIG_DROME (Q86BY9) Protein rigor mortis| Length = 1235 Score = 32.0 bits (71), Expect = 1.4 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Frame = -3 Query: 398 STNSTAGSYPHQCWLLQMEASEL------GDRSCRRSHSGQPENHQYSAYRFHTNNDQI 240 +TNS SY +L M+AS+L + CRRS P NHQ + R ND + Sbjct: 121 TTNSVLMSYLANGNILSMDASDLVIYCVASNTYCRRSTFISPRNHQLTMVRCSPYNDNL 179
>GUNC_PSEFL (P27033) Endoglucanase C precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) (EGC) (Cellodextrinase C) Length = 748 Score = 29.3 bits (64), Expect = 9.2 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -3 Query: 248 DQIKGTPRRSQPVIFLQERGLNPEDIQCAGIQG 150 D++ +P P +F+Q + ++P +CAG++G Sbjct: 582 DRLLFSPHTYGPSVFVQRQFMDPAQTECAGLEG 614
>YS89_CAEEL (Q09624) Hypothetical protein ZK945.9| Length = 3178 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 69 SSFSCCIPCPDSIAMFRTIFT 7 S FSCC+ C + I +FR IFT Sbjct: 15 SFFSCCLFCSEFIFVFRRIFT 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,876,991 Number of Sequences: 219361 Number of extensions: 1750428 Number of successful extensions: 4446 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4446 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)